Rabbit anti-Human, Mouse CTSD Polyclonal Antibody | anti-CTSD antibody

CTSD (Cathepsin D, CPSD) APC

Cat. Num. AAA6375051

• Gene Names: CTSD; CPSD; CLN10; HEL-S-130P
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CTSD; Polyclonal Antibody; CTSD (Cathepsin D; CPSD) APC; anti-CTSD antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CTSD. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 412

• Applicable Applications for anti-CTSD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CTSD, aa1-412 (AAH16320.1).
• Immunogen Sequence: MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CTSD rabbit polyclonal antibody. Western Blot analysis of CTSD expression in A-431.)

Western Blot (WB)

(Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD polyclonal antibody. Lane 1: CTSD transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CTSD antibody

Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Product Categories/Family for anti-CTSD antibody

Antibodies; Cathepsin

NCBI and Uniprot Product Information

• NCBI GI #: 16740920
• NCBI GeneID: 1509
• NCBI Accession #: AAH16320.1
• NCBI GenBank Nucleotide #: NM_001909
• NCBI Official Full Name: Cathepsin D
• NCBI Official Synonym Full Names: cathepsin D
• NCBI Official Symbol: CTSD
• NCBI Official Synonym Symbols: CPSD; CLN10; HEL-S-130P
• NCBI Protein Information: cathepsin D
• Protein Family: Cathepsin

NCBI Description

This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015]