Mouse anti-Human CTNNBL1 Monoclonal Antibody | anti-CTNNBL1 antibody

CTNNBL1 (C20orf33, Beta-catenin-like Protein 1, Nuclear-associated Protein, Testis Development Protein NYD-SP19, FLJ21108, NAP, PP8304, DJ633O20.1)

Cat. Num. AAA6009460

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CTNNBL1; Monoclonal Antibody; CTNNBL1 (C20orf33; Beta-catenin-like Protein 1; Nuclear-associated Protein; Testis Development Protein NYD-SP19; FLJ21108; NAP; PP8304; DJ633O20.1); Anti -CTNNBL1 (C20orf33; anti-CTNNBL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 5F1
• Specificity: Recognizes human CTNNBL1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: EKHDMVRRGEIIDNDTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLENF

• Applicable Applications for anti-CTNNBL1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 40ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa210-311 from human CTNNBL1 with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB)

(CTNNBL1 monoclonal antibody, Western Blot analysis of CTNNBL1 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CTNNBL1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CTNNBL1 on HeLa cell. [antibody concentration 40ug/ml].)

Related Product Information for anti-CTNNBL1 antibody

Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. Participates in AID/AICDA-mediated Ig class switching recombination (CSR). May induce apoptosis.

Product Categories/Family for anti-CTNNBL1 antibody

Antibodies; Abs to Catenin

NCBI and Uniprot Product Information

• NCBI GI #: 86438444
• NCBI GeneID: 282421
• UniProt Accession #: O62703; Q2KI34
• Molecular Weight: 65,184 Da
• NCBI Official Full Name: CTNNBL1 protein
• NCBI Official Synonym Full Names: catenin, beta like 1<
• NCBI Official Symbol: CTNNBL1
• NCBI Protein Information: beta-catenin-like protein 1; NAP; p14; nuclear-associated protein
• UniProt Protein Name: Beta-catenin-like protein 1
• Protein Family: Beta-catenin-like protein
• UniProt Gene Name: CTNNBL1
• UniProt Synonym Gene Names: NAP
• UniProt Entry Name: CTBL1_BOVIN

Uniprot Description

Function: Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. Participates in AID/AICDA-mediated Ig class switching recombination (CSR)

By similarity.

Subunit structure: Component of the PRP19-CDC5L splicing complex composed of a core complex comprising a homotetramer of PRPF19, CDC5L, PLRG1 and BCAS2, and at least three less stably associated proteins CTNNBL1, CWC15 and HSPA8. Interacts directly with CWC15 and CDC5L in the complex. Interacts with AICDA; the interaction is important for the antibody diversification activity of AICDA. Interacts with PRPF31 (via its NLS). Interacts (via its N-terminal NLS) with KPNA1 and KPNA2

By similarity.

Subcellular location: Nucleus

By similarity.

Sequence caution: The sequence AAC17837.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.