Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CTNNBL1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CTNNBL1 Polyclonal Antibody | anti-CTNNBL1 antibody

CTNNBL1 Antibody - N-terminal region

Gene Names
CTNNBL1; NAP; P14L; PP8304; C20orf33; dJ633O20.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CTNNBL1; Polyclonal Antibody; CTNNBL1 Antibody - N-terminal region; anti-CTNNBL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEAD
Sequence Length
563
Applicable Applications for anti-CTNNBL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTNNBL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CTNNBL1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CTNNBL1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CTNNBL1 antibody
The protein encoded by this gene is a component of the pre-mRNA-processing factor 19-cell division cycle 5-like (PRP19-CDC5L) protein complex, which activates pre-mRNA splicing and is an integral part of the spliceosome. The encoded protein is also a nuclear localization sequence binding protein, and binds to activation-induced deaminase and is important for antibody diversification. This gene may also be associated with the development of obesity. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome.
Product Categories/Family for anti-CTNNBL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61 kDa
NCBI Official Full Name
Beta-catenin-like protein 1
NCBI Official Synonym Full Names
catenin beta like 1
NCBI Official Symbol
CTNNBL1
NCBI Official Synonym Symbols
NAP; P14L; PP8304; C20orf33; dJ633O20.1
NCBI Protein Information
beta-catenin-like protein 1
UniProt Protein Name
Beta-catenin-like protein 1
Protein Family
UniProt Gene Name
CTNNBL1
UniProt Synonym Gene Names
C20orf33; NAP
UniProt Entry Name
CTBL1_HUMAN

NCBI Description

The protein encoded by this gene is a component of the pre-mRNA-processing factor 19-cell division cycle 5-like (PRP19-CDC5L) protein complex, which activates pre-mRNA splicing and is an integral part of the spliceosome. The encoded protein is also a nuclear localization sequence binding protein, and binds to activation-induced deaminase and is important for antibody diversification. This gene may also be associated with the development of obesity. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome. [provided by RefSeq, Jul 2013]

Uniprot Description

CTNNBL1: Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. Participates in AID/AICDA-mediated Ig class switching recombination (CSR). May induce apoptosis. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 20q11.23-q12

Cellular Component: nucleoplasm; spliceosome; membrane; cytoplasm; nucleus

Molecular Function: protein binding; enzyme binding

Biological Process: nuclear mRNA splicing, via spliceosome; somatic diversification of immunoglobulins; positive regulation of apoptosis; apoptosis; RNA splicing; gene expression

Research Articles on CTNNBL1

Similar Products

Product Notes

The CTNNBL1 ctnnbl1 (Catalog #AAA3221905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTNNBL1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTNNBL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTNNBL1 ctnnbl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GELLSYQPNR GTKRPRDDEE EEQKMRRKQT GTRERGRYRE EEMTVVEEAD. It is sometimes possible for the material contained within the vial of "CTNNBL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.