SDS-PAGE
Inositol-1-monophosphatase Recombinant Protein | ssyA recombinant protein
Recombinant E Coli Inositol-1-monophosphatase
Gene Names
suhB; ECK2530; JW2517; ssyA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inositol-1-monophosphatase; Recombinant E Coli Inositol-1-monophosphatase; ssyA recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-267aa; Full Length
Sequence
MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNIVAGNPRVVKAMLANMRDELSDALKR
Sequence Length
267
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
A mutation that enhances synthesis of sigma 32 and suppresses temperature-sensitive growth of the rpoH15 mutant of Escherichia coli.Yano R., Nagai H., Shiba K., Yura T.J. Bacteriol. 172:2124-2130(1990)
Construction of a contiguous 874-kb sequence of the Escherichia coli-K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features.Yamamoto Y., Aiba H., Baba T., Hayashi K., Inada T., Isono K., Itoh T., Kimura S., Kitagawa M., Makino K., Miki T., Mitsuhashi N., Mizobuchi K., Mori H., Nakade S., Nakamura Y., Nashimoto H., Oshima T., Oyama S., Saito N., Sampei G., Satoh Y., Sivasundaram S., Tagami H., Takahashi H., Takeda J., Takemoto K., Uehara K., Wada C., Yamagata S., Horiuchi T.DNA Res. 4:91-113(1997)
The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997)
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Inositol monophosphatase activity from the Escherichia coli suhB gene product.Matsuhisa A., Suzuki N., Noda T., Shiba K.J. Bacteriol. 177:200-205(1995)
Overexpression, purification, and analysis of complementation behavior of E. coli SuhB protein
comparison with bacterial and archaeal inositol monophosphatases.Chen L., Roberts M.F.Biochemistry 39:4145-4153(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.2 kDa
NCBI Official Full Name
inositol monophosphatase
NCBI Official Symbol
suhB
NCBI Official Synonym Symbols
ECK2530; JW2517; ssyA
NCBI Protein Information
inositol monophosphatase
UniProt Protein Name
Inositol-1-monophosphatase
Protein Family
UniProt Gene Name
suhB
UniProt Synonym Gene Names
ssyA; I-1-Pase; IMPase; Inositol-1-phosphatase
UniProt Entry Name
SUHB_ECOLI
NCBI Description
The N-terminal sequence was determined using protein made with a synthetic RBS, and thus is not a confirmation of the in vivo start site; the N-terminal Met was not clipped off the recombinant protein. [More information is available at EcoGene: EG10983]. The suhB gene has been shown to encode a protein with inositol monophosphatase and glycerol-2-phosphatase activity . [More information is available at EcoCyc: EG10983].
Research Articles on ssyA
Similar Products
Product Notes
The ssyA suhb (Catalog #AAA717413) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-267aa; Full Length. The amino acid sequence is listed below: MHPMLNIAVR AARKAGNLIA KNYETPDAVE ASQKGSNDFV TNVDKAAEAV IIDTIRKSYP QHTIITEESG ELEGTDQDVQ WVIDPLDGTT NFIKRLPHFA VSIAVRIKGR TEVAVVYDPM RNELFTATRG QGAQLNGYRL RGSTARDLDG TILATGFPFK AKQYATTYIN IVGKLFNECA DFRRTGSAAL DLAYVAAGRV DGFFEIGLRP WDFAAGELLV REAGGIVSDF TGGHNYMLTG NIVAGNPRVV KAMLANMRDE LSDALKR. It is sometimes possible for the material contained within the vial of "Inositol-1-monophosphatase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
