Mouse anti-Human CSTF1 Monoclonal Antibody | anti-CSTF1 antibody

CSTF1 (Cleavage Stimulation Factor Subunit 1, CF-1 50kD Subunit, Cleavage Stimulation Factor 50kD Subunit, CSTF 50kD Subunit, CstF-50) (HRP)

Cat. Num. AAA6151995

• Gene Names: CSTF1; CstF-50; CstFp50
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CSTF1; Monoclonal Antibody; CSTF1 (Cleavage Stimulation Factor Subunit 1; CF-1 50kD Subunit; Cleavage Stimulation Factor 50kD Subunit; CSTF 50kD Subunit; CstF-50) (HRP); anti-CSTF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C6
• Specificity: Recognizes human CSTF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CSTF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa332-431 from human CSTF1 (NP_001315.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CSTF1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-CSTF1 antibody

One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.

Product Categories/Family for anti-CSTF1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4557491
• NCBI GeneID: 1477
• NCBI Accession #: NP_001315.1
• NCBI GenBank Nucleotide #: NM_001324
• UniProt Accession #: Q05048; Q5QPD8
• Molecular Weight: 48,358 Da
• NCBI Official Full Name: cleavage stimulation factor subunit 1
• NCBI Official Synonym Full Names: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
• NCBI Official Symbol: CSTF1
• NCBI Official Synonym Symbols: CstF-50; CstFp50
• NCBI Protein Information: cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; CSTF 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD
• UniProt Protein Name: Cleavage stimulation factor subunit 1
• Protein Family: Cleavage stimulation factor
• UniProt Gene Name: CSTF1
• UniProt Synonym Gene Names: CSTF 50 kDa subunit; CstF-50
• UniProt Entry Name: CSTF1_HUMAN

NCBI Description

This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CSTF1: one of three subunits of cleavage stimulation factor (CSTF), a polyadenylation factor that cleaves the 3a??a??end of pre-mRNAs. Binds to the C-terminal ankyrin and tandem BRCT repeat domains of BARD1 (BRCA1-associated RING domain protein), modulating mRNA processing and RNAP II stability in response to DNA damage. The BARD1-CstF-50 interaction inhibits polyadenylation in vitro. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. WD domains are responsible for interaction with CSTF3. The sixth WD40 domain is required for interaction with BARD1.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nucleus

Molecular Function: protein binding; RNA binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; RNA splicing; gene expression; mRNA polyadenylation; mRNA 3'-end processing; termination of RNA polymerase II transcription; mRNA cleavage