Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CSTF1 Monoclonal Antibody | anti-CSTF1 antibody

CSTF1 (Cleavage Stimulation Factor Subunit 1, CF-1 50kD Subunit, Cleavage Stimulation Factor 50kD Subunit, CSTF 50kD Subunit, CstF-50) (AP)

Gene Names
CSTF1; CstF-50; CstFp50
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSTF1; Monoclonal Antibody; CSTF1 (Cleavage Stimulation Factor Subunit 1; CF-1 50kD Subunit; Cleavage Stimulation Factor 50kD Subunit; CSTF 50kD Subunit; CstF-50) (AP); anti-CSTF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes human CSTF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CSTF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa332-431 from human CSTF1 (NP_001315.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CSTF1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSTF1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CSTF1 antibody
One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA.
Product Categories/Family for anti-CSTF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,358 Da
NCBI Official Full Name
cleavage stimulation factor subunit 1
NCBI Official Synonym Full Names
cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
NCBI Official Symbol
CSTF1
NCBI Official Synonym Symbols
CstF-50; CstFp50
NCBI Protein Information
cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; CSTF 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD
UniProt Protein Name
Cleavage stimulation factor subunit 1
UniProt Gene Name
CSTF1
UniProt Synonym Gene Names
CSTF 50 kDa subunit; CstF-50
UniProt Entry Name
CSTF1_HUMAN

NCBI Description

This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CSTF1: one of three subunits of cleavage stimulation factor (CSTF), a polyadenylation factor that cleaves the 3a??a??end of pre-mRNAs. Binds to the C-terminal ankyrin and tandem BRCT repeat domains of BARD1 (BRCA1-associated RING domain protein), modulating mRNA processing and RNAP II stability in response to DNA damage. The BARD1-CstF-50 interaction inhibits polyadenylation in vitro. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. WD domains are responsible for interaction with CSTF3. The sixth WD40 domain is required for interaction with BARD1.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nucleus

Molecular Function: protein binding; RNA binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; RNA splicing; gene expression; mRNA polyadenylation; mRNA 3'-end processing; termination of RNA polymerase II transcription; mRNA cleavage

Research Articles on CSTF1

Similar Products

Product Notes

The CSTF1 cstf1 (Catalog #AAA6130783) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSTF1 (Cleavage Stimulation Factor Subunit 1, CF-1 50kD Subunit, Cleavage Stimulation Factor 50kD Subunit, CSTF 50kD Subunit, CstF-50) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSTF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSTF1 cstf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSTF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.