Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human CREB3 Monoclonal Antibody | anti-CREB3 antibody

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP)

Gene Names
CREB3; LZIP; LUMAN; sLZIP
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREB3; Monoclonal Antibody; CREB3 (LZIP; Cyclic AMP-responsive Element-binding Protein 3; Leucin Zipper Proitein; Luman; Transcription Factor LZIP-alpha; Processed Cyclic AMP-responsive Element-binding Protein 3) (AP); anti-CREB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H5
Specificity
Recognizes human CREB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CREB3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa273-371 from CREB3 (NP_006359) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of CREB3 expression in transfected 293T cell line by CREB3 monoclonal antibody. Lane 1: CREB3 transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CREB3 expression in transfected 293T cell line by CREB3 monoclonal antibody. Lane 1: CREB3 transfected lysate (41.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CREB3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CREB3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CREB3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CREB3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CREB3 over-expressed 293 cell line, cotransfected with CREB3 Validated Chimera RNAi ( (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CREB3 over-expressed 293 cell line, cotransfected with CREB3 Validated Chimera RNAi ( (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-CREB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,580 Da
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3
NCBI Official Symbol
CREB3
NCBI Official Synonym Symbols
LZIP; LUMAN; sLZIP
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3; CREB-3; basic leucine zipper protein; cAMP-responsive element-binding protein 3; cyclic AMP response element (CRE)-binding protein/activating transcription factor 1; leucin zipper proitein; small leucine zi
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 3
Protein Family
UniProt Gene Name
CREB3
UniProt Synonym Gene Names
LZIP; CREB-3; cAMP-responsive element-binding protein 3; N-terminal Luman; Transcriptionally active form
UniProt Entry Name
CREB3_HUMAN

Uniprot Description

CREB3: Endoplasmic reticulum (ER)-bound transcription factor that plays a role in the unfolded protein response (UPR). Involved in cell proliferation and migration, tumor suppression and inflammatory gene expression. Plays also a role in the human immunodeficiency virus type 1 (HIV-1) virus protein expression and in the herpes simplex virus-1 (HSV-1) latent infection and reactivation from latency. Isoform 2 plays a role in the unfolded protein response (UPR). Isoform 2 acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration. Isoform 2 may play a role as a cellular tumor suppressor that is targeted by the hepatitis C virus (HSV) core protein. Isoform 2 represses the VP16-mediated transactivation of immediate early genes of the HSV-1 virus by sequestring host cell factor-1 HCFC1 in the ER membrane of sensory neurons, thereby preventing the initiation of the replicative cascade leading to latent infection. Isoform 3 functions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Isoform 3 decreases the acetylation level of histone H4. Isoform 3 does not promote the chemotactic activity of leukocyte cells. Belongs to the bZIP family. ATF subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: Golgi membrane; Golgi apparatus; nuclear body; endoplasmic reticulum membrane; membrane; cell soma; endoplasmic reticulum; cytoplasm; integral to membrane; integral to endoplasmic reticulum membrane; cytosol; nucleus

Molecular Function: protein dimerization activity; CCR1 chemokine receptor binding; protein binding; protein homodimerization activity; DNA binding; cAMP response element binding protein binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; cytoplasmic sequestering of transcription factor; viral reproduction; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of transcription of target genes involved in unfolded protein response; establishment of viral latency; chemotaxis; induction of positive chemotaxis; negative regulation of cell cycle; regulation of cell proliferation; reactivation of latent virus; positive regulation of transcription from RNA polymerase II promoter; regulation of cell growth; positive regulation of calcium ion transport; positive regulation of defense response to virus by host; positive regulation of cell migration

Similar Products

Product Notes

The CREB3 creb3 (Catalog #AAA6130741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREB3 creb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.