<
Western Blot (WB)
(CPSF6 monoclonal antibody (M07), clone 1C5. Western Blot analysis of CPSF6 expression in NIH/3T3 (Cat # L018V1).)
Mouse CPSF6 Monoclonal Antibody | anti-CPSF6 antibody
CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kD, CFIM, CFIM68, HPBRII-4, HPBRII-7) (FITC)
Gene Names
CPSF6; CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CPSF6; Monoclonal Antibody; CPSF6 (Cleavage and Polyadenylation Specific Factor 6; 68kD; CFIM; CFIM68; HPBRII-4; HPBRII-7) (FITC); Cleavage and Polyadenylation Specific Factor 6; HPBRII-7; anti-CPSF6 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C5
Specificity
Recognizes CPSF6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CPSF6 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CPSF6 (NP_008938, 37aa-136aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CPSF6 monoclonal antibody (M07), clone 1C5. Western Blot analysis of CPSF6 expression in NIH/3T3 (Cat # L018V1).)
Western Blot (WB)
(CPSF6 monoclonal antibody (M07), clone 1C5. Western Blot analysis of CPSF6 expression in NIH/3T3 (Cat # L018V1).)
Testing Data
(Detection limit for recombinant GST tagged CPSF6 is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CPSF6 is 0.3 ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CPSF6 antibody
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins. [provided by RefSeq]
Product Categories/Family for anti-CPSF6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 6 isoform 1
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 6
NCBI Official Symbol
CPSF6
NCBI Official Synonym Symbols
CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 6
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 6
Protein Family
UniProt Gene Name
CPSF6
UniProt Synonym Gene Names
CFIM68
UniProt Entry Name
CPSF6_HUMAN
NCBI Description
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins. [provided by RefSeq, Jul 2008]
Research Articles on CPSF6
Similar Products
Product Notes
The CPSF6 cpsf6 (Catalog #AAA6177010) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CPSF6 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPSF6 cpsf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPSF6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
