Immunofluorescence (IF)
(Sample Type :SKOV3Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :CPSF6)
Rabbit CPSF6 Polyclonal Antibody | anti-CPSF6 antibody
CPSF6 antibody - middle region
Gene Names
CPSF6; CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CPSF6; Polyclonal Antibody; CPSF6 antibody - middle region; anti-CPSF6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
Sequence Length
551
Applicable Applications for anti-CPSF6 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CPSF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunofluorescence (IF)
(Sample Type :SKOV3Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :CPSF6)
Immunofluorescence (IF)
(Sample Type :SKOV3Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :CPSF6)
Immunohistochemistry (IHC)
(Rabbit Anti-CPSF6 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 16.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-CPSF6 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 16.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-CPSF6 Antibody Titration: 0.3125ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateCPSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Western Blot (WB)
(WB Suggested Anti-CPSF6 Antibody Titration: 0.3125ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateCPSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-CPSF6 antibody
This is a rabbit polyclonal antibody against CPSF6. It was validated on Western Blot and immunohistochemistry
Target Description: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
Target Description: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
Product Categories/Family for anti-CPSF6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 6 isoform 1
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 6
NCBI Official Symbol
CPSF6
NCBI Official Synonym Symbols
CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 6
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 6
Protein Family
UniProt Gene Name
CPSF6
UniProt Synonym Gene Names
CFIM68
UniProt Entry Name
CPSF6_HUMAN
NCBI Description
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins. [provided by RefSeq, Jul 2008]
Research Articles on CPSF6
Similar Products
Product Notes
The CPSF6 cpsf6 (Catalog #AAA3205421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPSF6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CPSF6 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CPSF6 cpsf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPLAGPPNRG DRPPPPVLFP GQPFGQPPLG PLPPGPPPPV PGYGPPPGPP. It is sometimes possible for the material contained within the vial of "CPSF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
