Mouse anti-Human CPSF3 Monoclonal Antibody | anti-CPSF3 antibody

CPSF3 (Cleavage and Polyadenylation Specificity Factor Subunit 3, Cleavage and Polyadenylation Specificity Factor 73kD Subunit, CPSF 73kD Subunit, mRNA 3'-end-processing Endonuclease CPSF-73, CPSF73) (HRP)

Cat. Num. AAA6151943

• Gene Names: CPSF3; CPSF73; CPSF-73
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CPSF3; Monoclonal Antibody; CPSF3 (Cleavage and Polyadenylation Specificity Factor Subunit 3; Cleavage and Polyadenylation Specificity Factor 73kD Subunit; CPSF 73kD Subunit; mRNA 3'-end-processing Endonuclease CPSF-73; CPSF73) (HRP); anti-CPSF3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6E6
• Specificity: Recognizes human CPSF3. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Concentration: 1mg/ml (varies by lot)
• Sequence: LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH

• Applicable Applications for anti-CPSF3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Optimal dilutions to be determined by the researcher.
• Immunogen: Partial recombinant corresponding to aa585-685, from human CPSF3 with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using MBS648407 (37.11kD).)

Western Blot (WB)

(Western Blot analysis of CPSF3 expression in PC-12 using MBS648407)

Western Blot (WB)

(Western Blot analysis of CPSF3 expression in Hela NE using MBS648407.)

Testing Data

(Detection limit for recombinant GST tagged CPSF3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CPSF3 expression in transfected 293T cell line by CPSF3 monoclonal antibody. Lane 1: CPSF3 transfected lysate (77.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CPSF3 antibody

Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Has endonuclease activity, and functions as mRNA 3'-end-processing endonuclease. Also involved in the histone 3'-end pre-mRNA processing. U7 snRNP-dependent protein that induces both the 3'-endoribonucleolytic cleavage of histone pre-mRNAs and acts as a 5' to 3' exonuclease for degrading the subsequent downstream cleavage product (DCP) of mature histone mRNAs. Cleavage occurs after the 5'-ACCCA-3' sequence in the histone pre-mRNA leaving a 3'hydroxyl group on the upstream fragment containing the stem loop (SL) and 5' phosphate on the downstream cleavage product (DCP) starting with CU nucleotides. The U7-dependent 5' to 3' exonuclease activity is processive and degrades the DCP RNA substrate even after complete removal of the U7-binding site. Binds to the downstream cleavage product (DCP) of histone pre-mRNAs and the cleaved DCP RNA substrate in a U7 snRNP dependent manner.

Product Categories/Family for anti-CPSF3 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7706427
• NCBI GeneID: 51692
• NCBI Accession #: NP_057291
• NCBI GenBank Nucleotide #: NM_016207
• UniProt Accession #: Q53RS2; O14769; Q96F36; Q9UKF6
• NCBI Official Full Name: cleavage and polyadenylation specificity factor subunit 3
• NCBI Official Synonym Full Names: cleavage and polyadenylation specific factor 3, 73kDa
• NCBI Official Symbol: CPSF3
• NCBI Official Synonym Symbols: CPSF73; CPSF-73
• NCBI Protein Information: cleavage and polyadenylation specificity factor subunit 3; mRNA 3'-end-processing endonuclease CPSF-73
• UniProt Protein Name: Cleavage and polyadenylation specificity factor subunit 3
• Protein Family: Cleavage and polyadenylation specificity factor
• UniProt Gene Name: CPSF3
• UniProt Synonym Gene Names: CPSF73; CPSF 73 kDa subunit
• UniProt Entry Name: CPSF3_HUMAN