Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Mouse anti-Human COX5B Monoclonal Antibody | anti-COX5B antibody

COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) APC

Gene Names
COX5B; COXVB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COX5B; Monoclonal Antibody; COX5B (Cytochrome C Oxidase Subunit 5B; Cytochrome C Oxidase Polypeptide VB Mitochondrial; Cytochrome C Oxidase Subunit Vb; COXVB) APC; anti-COX5B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E8
Specificity
Recognizes human COX5B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-COX5B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa37-128 from human COX5B (NP_001853) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.86kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.86kD).)

Western Blot (WB)

(COX5B monoclonal antibody Western Blot analysis of COX5B expression in HepG2.)

Western Blot (WB) (COX5B monoclonal antibody Western Blot analysis of COX5B expression in HepG2.)
Related Product Information for anti-COX5B antibody
Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme.
Product Categories/Family for anti-COX5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13 kDa (121aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
NCBI Official Full Name
cytochrome c oxidase subunit 5B, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 5B
NCBI Official Symbol
COX5B
NCBI Official Synonym Symbols
COXVB
NCBI Protein Information
cytochrome c oxidase subunit 5B, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 5B, mitochondrial
UniProt Gene Name
COX5B
UniProt Entry Name
COX5B_HUMAN

NCBI Description

Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008]

Uniprot Description

COX5B: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Belongs to the cytochrome c oxidase subunit 5B family.

Protein type: Energy Metabolism - oxidative phosphorylation; EC 1.9.3.1; Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: cytochrome-c oxidase activity; metal ion binding

Biological Process: cellular metabolic process; respiratory gaseous exchange; transmembrane transport

Research Articles on COX5B

Similar Products

Product Notes

The COX5B cox5b (Catalog #AAA6136024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COX5B (Cytochrome C Oxidase Subunit 5B, Cytochrome C Oxidase Polypeptide VB Mitochondrial, Cytochrome C Oxidase Subunit Vb, COXVB) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COX5B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COX5B cox5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COX5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.