Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VIL2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EZR Polyclonal Antibody | anti-EZR antibody

EZR Antibody - C-terminal region

Gene Names
EZR; CVL; CVIL; VIL2; HEL-S-105
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EZR; Polyclonal Antibody; EZR Antibody - C-terminal region; anti-EZR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLS
Sequence Length
586
Applicable Applications for anti-EZR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human VIL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VIL2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VIL2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EZR antibody
The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene.
Product Categories/Family for anti-EZR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
ezrin
NCBI Official Synonym Full Names
ezrin
NCBI Official Symbol
EZR
NCBI Official Synonym Symbols
CVL; CVIL; VIL2; HEL-S-105
NCBI Protein Information
ezrin
UniProt Protein Name
Ezrin
Protein Family
UniProt Gene Name
EZR
UniProt Synonym Gene Names
VIL2
UniProt Entry Name
EZRI_HUMAN

NCBI Description

The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Ezrin: a member of the ERM family which includes radixin and moesin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Plays a key role in cell surface structure adhesion, migration, and organization.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: cortical cytoskeleton; extracellular space; focal adhesion; microvillus; basolateral plasma membrane; T-tubule; actin filament; cytosol; actin cytoskeleton; lipid raft; ruffle; extrinsic to membrane; membrane; microvillus membrane; apical part of cell; apical plasma membrane; plasma membrane; nucleolus; uropod; vesicle; filopodium

Molecular Function: actin filament binding; protein domain specific binding; protein binding; cell adhesion molecule binding

Biological Process: microvillus biogenesis; axon guidance; actin filament bundle formation; regulation of cell shape; leukocyte adhesion; filopodium formation; cytoskeletal anchoring; receptor internalization; membrane to membrane docking; establishment of epithelial cell polarity

Research Articles on EZR

Similar Products

Product Notes

The EZR ezr (Catalog #AAA3224288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EZR Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EZR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EZR ezr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QESLQDEGAE PTGYSAELSS EGIRDDRNEE KRITEAEKNE RVQRQLLTLS. It is sometimes possible for the material contained within the vial of "EZR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.