Mouse COX17 Monoclonal Antibody | anti-COX17 antibody

COX17 (COX17 Cytochrome c Oxidase Assembly Homolog (S. cerevisiae), MGC104397, MGC117386) (APC)

Cat. Num. AAA6168351

• Applications: Western Blot
• Purity: Purified
• Synonyms: COX17; Monoclonal Antibody; COX17 (COX17 Cytochrome c Oxidase Assembly Homolog (S. cerevisiae); MGC104397; MGC117386) (APC); COX17 Cytochrome c Oxidase Assembly Homolog (S. cerevisiae); MGC117386; anti-COX17 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A9
• Specificity: Recognizes COX17.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 63

• Applicable Applications for anti-COX17 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: COX17 (NP_005685, 1aa-63aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged COX17 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-COX17 antibody

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq]

Product Categories/Family for anti-COX17 antibody

Antibodies; Enzymes; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 5031645
• NCBI GeneID: 10063
• NCBI Accession #: NP_005685
• NCBI GenBank Nucleotide #: NP_005685.1
• UniProt Accession #: Q14061
• NCBI Official Full Name: cytochrome c oxidase copper chaperone isoform b
• NCBI Official Synonym Full Names: cytochrome c oxidase copper chaperone COX17
• NCBI Official Symbol: COX17
• NCBI Protein Information: cytochrome c oxidase copper chaperone
• UniProt Protein Name: Cytochrome c oxidase copper chaperone
• Protein Family: Cytochrome c oxidase copper chaperone
• UniProt Gene Name: COX17
• UniProt Entry Name: COX17_HUMAN

NCBI Description

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq, Jul 2008]

Uniprot Description

COX17: Copper chaperone for cytochrome c oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX. Belongs to the COX17 family.

Protein type: Mitochondrial; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 3q13.33

Cellular Component: mitochondrion; cytoplasm; mitochondrial intermembrane space

Molecular Function: copper ion binding; copper chaperone activity

Biological Process: generation of precursor metabolites and energy; heart development; brain development; copper ion transport