Western Blot (WB)
(Sample Type: transfected HEK293-CYP11B2Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)2. HEK293TN-GFP-hcyp11B2 (75ug)Primary dilution: 1:100Secondary Antibody: mouse anti-Rabbit HRPSecondary Dilution: 1:10,000Film Exposed for: 15 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center)
Rabbit anti-Horse, Human CYP11B2 Polyclonal Antibody | anti-CYP11B2 antibody
CYP11B2 antibody - middle region
Gene Names
CYP11B2; CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP11B2; Polyclonal Antibody; CYP11B2 antibody - middle region; anti-CYP11B2 antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Sequence Length
503
Applicable Applications for anti-CYP11B2 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: transfected HEK293-CYP11B2Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)2. HEK293TN-GFP-hcyp11B2 (75ug)Primary dilution: 1:100Secondary Antibody: mouse anti-Rabbit HRPSecondary Dilution: 1:10,000Film Exposed for: 15 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center)
Western Blot (WB)
(Sample Type: transfected HEK293-CYP11B2Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug)2. HEK293TN-GFP-hcyp11B2 (75ug)Primary dilution: 1:100Secondary Antibody: mouse anti-Rabbit HRPSecondary Dilution: 1:10,000Film Exposed for: 15 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center)
Western Blot (WB)
(WB Suggested Anti-CYP11B2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-CYP11B2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-CYP11B2 antibody
This is a rabbit polyclonal antibody against CYP11B2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Product Categories/Family for anti-CYP11B2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
cytochrome P450 11B2, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450 family 11 subfamily B member 2
NCBI Official Symbol
CYP11B2
NCBI Official Synonym Symbols
CPN2; ALDOS; CYP11B; CYP11BL; CYPXIB2; P450C18; P-450C18; P450aldo
NCBI Protein Information
cytochrome P450 11B2, mitochondrial
UniProt Protein Name
Cytochrome P450 11B2, mitochondrial
Protein Family
UniProt Gene Name
CYP11B2
UniProt Synonym Gene Names
ALDOS
UniProt Entry Name
C11B2_HUMAN
NCBI Description
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has steroid 18-hydroxylase activity to synthesize aldosterone and 18-oxocortisol as well as steroid 11 beta-hydroxylase activity. Mutations in this gene cause corticosterone methyl oxidase deficiency. [provided by RefSeq, Jul 2008]
Research Articles on CYP11B2
Similar Products
Product Notes
The CYP11B2 cyp11b2 (Catalog #AAA3206014) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP11B2 antibody - middle region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP11B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP11B2 cyp11b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRLAEAEMLL LLHHVLKHFL VETLTQEDIK MVYSFILRPG TSPLLTFRAI. It is sometimes possible for the material contained within the vial of "CYP11B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
