Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADAMDEC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)

Rabbit ADAMDEC1 Polyclonal Antibody | anti-ADAMDEC1 antibody

ADAMDEC1 antibody - middle region

Gene Names
ADAMDEC1; M12.219
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADAMDEC1; Polyclonal Antibody; ADAMDEC1 antibody - middle region; anti-ADAMDEC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
Sequence Length
470
Applicable Applications for anti-ADAMDEC1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADAMDEC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-ADAMDEC1 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
Related Product Information for anti-ADAMDEC1 antibody
This is a rabbit polyclonal antibody against ADAMDEC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i
Product Categories/Family for anti-ADAMDEC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
ADAM DEC1 isoform 1
NCBI Official Synonym Full Names
ADAM like decysin 1
NCBI Official Symbol
ADAMDEC1
NCBI Official Synonym Symbols
M12.219
NCBI Protein Information
ADAM DEC1
UniProt Protein Name
ADAM DEC1
Protein Family
UniProt Gene Name
ADAMDEC1
UniProt Synonym Gene Names
ADAM-like protein decysin-1
UniProt Entry Name
ADEC1_HUMAN

NCBI Description

This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play an important role in the control of the immune response and during pregnancy

By similarity.

Cofactor: Binds 1 zinc ion per subunit

By similarity.

Subcellular location: Secreted

By similarity.

Tissue specificity: Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC. Ref.1 Ref.5

Induction: Induced during DC maturation and up-regulated in response to T-cell signals. In macrophage up-regulated by bacterial lipopolysaccharides (LPS). Up-regulated by 1-alpha,25-dihydroxyvitamin D3 during differentiation of primary monocyte into macrophage. Ref.1 Ref.5

Sequence similarities: Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.

Research Articles on ADAMDEC1

Similar Products

Product Notes

The ADAMDEC1 adamdec1 (Catalog #AAA3212036) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAMDEC1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADAMDEC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAMDEC1 adamdec1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMPDVPFNTK CPSGSCVMNQ YLSSKFPKDF STSCRAHFER YLLSQKPKCL. It is sometimes possible for the material contained within the vial of "ADAMDEC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.