Testing Data
(Detection limit for recombinant GST tagged COTL1 is 0.3 ng/ml as a capture antibody.)
Mouse COTL1 Monoclonal Antibody | anti-COTL1 antibody
COTL1 (Coactosin-like 1 (Dictyostelium), CLP, FLJ43657, MGC19733) (AP)
Gene Names
COTL1; CLP
Applications
Western Blot
Purity
Purified
Synonyms
COTL1; Monoclonal Antibody; COTL1 (Coactosin-like 1 (Dictyostelium); CLP; FLJ43657; MGC19733) (AP); Coactosin-like 1 (Dictyostelium); MGC19733; anti-COTL1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A2
Specificity
Recognizes COTL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
142
Applicable Applications for anti-COTL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
COTL1 (AAH10884.1, 1aa-142aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged COTL1 is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged COTL1 is 0.3 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of COTL1 expression in transfected 293T cell line by COTL1 monoclonal antibody (M01), clone 1A2.Lane 1: COTL1 transfected lysate (Predicted MW: 15.9 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of COTL1 expression in transfected 293T cell line by COTL1 monoclonal antibody (M01), clone 1A2.Lane 1: COTL1 transfected lysate (Predicted MW: 15.9 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-COTL1 antibody
This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq]
Product Categories/Family for anti-COTL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Coactosin-like 1 (Dictyostelium)
NCBI Official Synonym Full Names
coactosin like F-actin binding protein 1
NCBI Official Symbol
COTL1
NCBI Official Synonym Symbols
CLP
NCBI Protein Information
coactosin-like protein
Protein Family
NCBI Description
This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008]
Research Articles on COTL1
Similar Products
Product Notes
The COTL1 (Catalog #AAA6165795) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COTL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COTL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COTL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
