Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Clusterin Monoclonal Antibody | anti-CLI antibody

Clusterin (AAG4, APOJ, Apo-J, Apolipoprotein J, CLI, Clusterin precursor, Complement-associated protein SP-40,40, Complement cytolysis inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed prostate message 2, TRPM2, TRPM-2) (MaxLi

Gene Names
CLU; CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Clusterin; Monoclonal Antibody; Clusterin (AAG4; APOJ; Apo-J; Apolipoprotein J; CLI; Clusterin precursor; Complement-associated protein SP-40; 40; Complement cytolysis inhibitor; KUB1; MGC24903; NA1/NA2; SGP2; SGP-2; SP-40; Testosterone-repressed prostate message 2; TRPM2; TRPM-2) (MaxLi; anti-CLI antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Specificity
Recognizes human CLU.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CLI antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa402-501 from human CLU (NP_001822) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CLI antibody
Clusterin is an ubiquitously expressed protein of two 40kD chains, alpha and beta, covalently joined by disulfide bonds. It exists in two forms; a pro-apoptotic form localized to the nucleus and a pro-survival secreted form. Both are thought to be involved in DNA repair and cell cycle regulation. The secreted form is thought to inhibit apoptotic signalling by BAX, Clusterin suppression can sensitise cells to chemotherapy. Clusterin is overexpressed in human prostate cancer, breast cancers and squamous cell carcinomas. Part of the SC5b-9 complex, clusterin prevents the binding of a C5b-C7 complex to the membrane of the target cell inhibiting the complement cascade. Clusterin acts as an extracellular chaperone inhibiting the formation of human lysozyme amyloid associated with Alzheimer's disease. Clusterin is also important in spermatogenesis and is secreted by Sertoli cells.
Product Categories/Family for anti-CLI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,643 Da
NCBI Official Full Name
clusterin isoform 1
NCBI Official Synonym Full Names
clusterin
NCBI Official Symbol
CLU
NCBI Official Synonym Symbols
CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
NCBI Protein Information
clusterin; apolipoprotein J; ku70-binding protein 1; sulfated glycoprotein 2; aging-associated protein 4; complement lysis inhibitor; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2
UniProt Protein Name
Clusterin
Protein Family
UniProt Gene Name
CLU
UniProt Synonym Gene Names
APOJ; CLI; KUB1; Apo-J; CLI; TRPM-2
UniProt Entry Name
CLUS_HUMAN

NCBI Description

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011]

Uniprot Description

CLU: Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress- induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. Belongs to the clusterin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Secreted; Secreted, signal peptide; Mitochondrial

Chromosomal Location of Human Ortholog: 8p21-p12

Cellular Component: extracellular matrix; Golgi apparatus; extracellular space; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; mitochondrial membrane; extracellular region; nucleus; cytosol

Molecular Function: protein binding; ubiquitin protein ligase binding; chaperone binding; ATPase activity; misfolded protein binding

Biological Process: platelet activation; response to misfolded protein; release of cytochrome c from mitochondria; positive regulation of nitric oxide biosynthetic process; protein stabilization; positive regulation of apoptosis; response to virus; cell morphogenesis; microglial cell activation; positive regulation of tumor necrosis factor production; activation of NF-kappaB transcription factor; complement activation; negative regulation of protein homooligomerization; platelet degranulation; reverse cholesterol transport; myelin maintenance in the central nervous system; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein import; innate immune response; lipid metabolic process; chaperone-mediated protein complex assembly; blood coagulation; complement activation, classical pathway

Research Articles on CLI

Similar Products

Product Notes

The CLI clu (Catalog #AAA6232217) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Clusterin (AAG4, APOJ, Apo-J, Apolipoprotein J, CLI, Clusterin precursor, Complement-associated protein SP-40,40, Complement cytolysis inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed prostate message 2, TRPM2, TRPM-2) (MaxLi reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Clusterin can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLI clu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Clusterin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.