Mouse anti-Human Clusterin Monoclonal Antibody | anti-CLI antibody

Clusterin (AAG4, APOJ, Apo-J, Apolipoprotein J, CLI, Clusterin precursor, Complement-associated protein SP-40,40, Complement cytolysis inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed prostate message 2, TRPM2, TRPM-2) (HRP)

Cat. Num. AAA6151866

• Gene Names: CLU; CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Clusterin; Monoclonal Antibody; Clusterin (AAG4; APOJ; Apo-J; Apolipoprotein J; CLI; Clusterin precursor; Complement-associated protein SP-40; 40; Complement cytolysis inhibitor; KUB1; MGC24903; NA1/NA2; SGP2; SGP-2; SP-40; Testosterone-repressed prostate message 2; TRPM2; TRPM-2) (HRP); anti-CLI antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A11
• Specificity: Recognizes human CLU.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CLI antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa402-501 from human CLU (NP_001822) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74D).)

Testing Data

(Detection limit for recombinant GST tagged CLU is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CLI antibody

Clusterin is an ubiquitously expressed protein of two 40kD chains, alpha and beta, covalently joined by disulfide bonds. It exists in two forms; a pro-apoptotic form localized to the nucleus and a pro-survival secreted form. Both are thought to be involved in DNA repair and cell cycle regulation. The secreted form is thought to inhibit apoptotic signalling by BAX, Clusterin suppression can sensitise cells to chemotherapy. Clusterin is overexpressed in human prostate cancer, breast cancers and squamous cell carcinomas. Part of the SC5b-9 complex, clusterin prevents the binding of a C5b-C7 complex to the membrane of the target cell inhibiting the complement cascade. Clusterin acts as an extracellular chaperone inhibiting the formation of human lysozyme amyloid associated with Alzheimer's disease. Clusterin is also important in spermatogenesis and is secreted by Sertoli cells.

Product Categories/Family for anti-CLI antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 42716297
• NCBI GeneID: 1191
• NCBI Accession #: NP_001822
• NCBI GenBank Nucleotide #: NM_001831
• UniProt Accession #: P10909; P11380; P11381; Q2TU75; Q5HYC1; Q7Z5B9; B2R9Q1; B3KSE6; AAB25217
• Molecular Weight: 53,643 Da
• NCBI Official Full Name: clusterin isoform 1
• NCBI Official Synonym Full Names: clusterin
• NCBI Official Symbol: CLU
• NCBI Official Synonym Symbols: CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
• NCBI Protein Information: clusterin; apolipoprotein J; ku70-binding protein 1; sulfated glycoprotein 2; aging-associated protein 4; complement lysis inhibitor; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2
• UniProt Protein Name: Clusterin
• Protein Family: Clusterin
• UniProt Gene Name: CLU
• UniProt Synonym Gene Names: APOJ; CLI; KUB1; Apo-J; CLI; TRPM-2
• UniProt Entry Name: CLUS_HUMAN

NCBI Description

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011]

Uniprot Description

CLU: Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress- induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation. Belongs to the clusterin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Secreted; Secreted, signal peptide; Mitochondrial

Chromosomal Location of Human Ortholog: 8p21-p12

Cellular Component: extracellular matrix; Golgi apparatus; extracellular space; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; mitochondrial membrane; extracellular region; nucleus; cytosol

Molecular Function: protein binding; ubiquitin protein ligase binding; chaperone binding; ATPase activity; misfolded protein binding

Biological Process: platelet activation; response to misfolded protein; release of cytochrome c from mitochondria; positive regulation of nitric oxide biosynthetic process; protein stabilization; positive regulation of apoptosis; response to virus; cell morphogenesis; microglial cell activation; positive regulation of tumor necrosis factor production; activation of NF-kappaB transcription factor; complement activation; negative regulation of protein homooligomerization; platelet degranulation; reverse cholesterol transport; myelin maintenance in the central nervous system; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein import; innate immune response; lipid metabolic process; chaperone-mediated protein complex assembly; blood coagulation; complement activation, classical pathway