Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CLEC10A Monoclonal Antibody | anti-CLEC10A antibody

CLEC10A (C-type Lectin Domain Family 10 Member A, C-type Lectin Superfamily Member 14, Macrophage Lectin 2, CD301, CLECSF13, CLECSF14, HML) (MaxLight 650)

Gene Names
CLEC10A; HML; MGL; HML2; CD301; CLECSF13; CLECSF14
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLEC10A; Monoclonal Antibody; CLEC10A (C-type Lectin Domain Family 10 Member A; C-type Lectin Superfamily Member 14; Macrophage Lectin 2; CD301; CLECSF13; CLECSF14; HML) (MaxLight 650); anti-CLEC10A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D6
Specificity
Recognizes human CLEC10A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CLEC10A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa70-169 from CLEC10A (NP_006335) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCY
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CLEC10A antibody
CLEC10A encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-CLEC10A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.3kDa (241aa) 28-40kDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
C-type lectin domain family 10 member A isoform 2
NCBI Official Synonym Full Names
C-type lectin domain containing 10A
NCBI Official Symbol
CLEC10A
NCBI Official Synonym Symbols
HML; MGL; HML2; CD301; CLECSF13; CLECSF14
NCBI Protein Information
C-type lectin domain family 10 member A
UniProt Protein Name
C-type lectin domain family 10 member A
UniProt Gene Name
CLEC10A
UniProt Synonym Gene Names
CLECSF13; CLECSF14; HML
UniProt Entry Name
CLC10_HUMAN

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CLEC10A: Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: carbohydrate binding

Biological Process: innate immune response; endocytosis

Research Articles on CLEC10A

Similar Products

Product Notes

The CLEC10A clec10a (Catalog #AAA6221520) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC10A (C-type Lectin Domain Family 10 Member A, C-type Lectin Superfamily Member 14, Macrophage Lectin 2, CD301, CLECSF13, CLECSF14, HML) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC10A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLEC10A clec10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLEC10A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.