Western Blot (WB)
(Western Blot analysis of CLEC10A expression in transfected 293T cell line by CLEC10A polyclonal antibody. Lane 1: CLEC10A transfected lysate (34.76kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human CLEC10A Polyclonal Antibody | anti-CLEC10A antibody
CLEC10A (C-type Lectin Domain Family 10 Member A, C-type Lectin Superfamily Member 14, Macrophage Lectin 2, CD301, CLECSF13, CLECSF14, HML)
Gene Names
CLEC10A; HML; MGL; HML2; CD301; CLECSF13; CLECSF14
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
CLEC10A; Polyclonal Antibody; CLEC10A (C-type Lectin Domain Family 10 Member A; C-type Lectin Superfamily Member 14; Macrophage Lectin 2; CD301; CLECSF13; CLECSF14; HML); Anti -CLEC10A (C-type Lectin Domain Family 10 Member A; anti-CLEC10A antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CLEC10A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Applicable Applications for anti-CLEC10A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human CLEC10A, aa1-316 (NP_878910.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of CLEC10A expression in transfected 293T cell line by CLEC10A polyclonal antibody. Lane 1: CLEC10A transfected lysate (34.76kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CLEC10A expression in transfected 293T cell line by CLEC10A polyclonal antibody. Lane 1: CLEC10A transfected lysate (34.76kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CLEC10A antibody
CLEC10A encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-CLEC10A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,446 Da
NCBI Official Full Name
C-type lectin domain family 10 member A isoform 2
NCBI Official Synonym Full Names
C-type lectin domain family 10, member A
NCBI Official Symbol
CLEC10A
NCBI Official Synonym Symbols
HML; MGL; HML2; CD301; CLECSF13; CLECSF14
NCBI Protein Information
C-type lectin domain family 10 member A; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived)
UniProt Protein Name
C-type lectin domain family 10 member A
Protein Family
UniProt Gene Name
CLEC10A
UniProt Synonym Gene Names
CLECSF13; CLECSF14; HML
UniProt Entry Name
CLC10_HUMAN
NCBI Description
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
CLEC10A: Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 17p13.1
Cellular Component: integral to membrane; plasma membrane
Molecular Function: carbohydrate binding
Biological Process: innate immune response; endocytosis
Research Articles on CLEC10A
Similar Products
Product Notes
The CLEC10A clec10a (Catalog #AAA643979) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC10A (C-type Lectin Domain Family 10 Member A, C-type Lectin Superfamily Member 14, Macrophage Lectin 2, CD301, CLECSF13, CLECSF14, HML) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC10A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CLEC10A clec10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTRTYENFQY LENKVKVQGF KNGPLPLQSL LQRLCSGPCH LLLSLGLGLL LLVIICVVGF QNSKFQRDLV TLRTDFSNFT SNTVAEIQAL TSQGSSLEET IASLKAEVEG FKQERQAGVS ELQEHTTQKA HLGHCPHCPS VCVPVHSEML LRVQQLVQDL KKLTCQVATL NNNASTEGTC CPVNWVEHQD SCYWFSHSGM SWAEAEKYCQ LKNAHLVVIN SREEQNFVQK YLGSAYTWMG LSDPEGAWKW VDGTDYATGF QNWKPGQPDD WQGHGLGGGE DCAHFHPDGR WNDDVCQRPY HWVCEAGLGQ TSQESH. It is sometimes possible for the material contained within the vial of "CLEC10A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
