Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of CLDN14 transfected lysate using CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 rabbit polyclonal antibody.)

Mouse anti-Human CLDN14 Monoclonal Antibody | anti-CLDN14 antibody

CLDN14 (Claudin-14, UNQ777/PRO1571) (HRP)

Gene Names
CLDN14; DFNB29
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLDN14; Monoclonal Antibody; CLDN14 (Claudin-14; UNQ777/PRO1571) (HRP); anti-CLDN14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D11
Specificity
Recognizes human CLDN14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CLDN14 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-82 from CLDN14 (NP_036262) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of CLDN14 transfected lysate using CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CLDN14 transfected lysate using CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CLDN14 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CLDN14 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CLDN14 antibody
These proteins consist of 4 hydrophobic transmembrane domains, 2 extracellular loops and short cytoplasmic tails at N and C-termini containing YV and PDZ-domain binding motifs. Claudin 14, a 25kD glycoprotein, is a novel member of this family. It is a vital component of inner ear tight junction strands. Its expression has been observed in sensory epithelium of inner organ of Corti, vestibular system, kidney and Liver. Mutations in Claudin 14 cause a congenital autosomal recessive form of nonsyndromic sensorineural deafness in humans.
Product Categories/Family for anti-CLDN14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,699 Da
NCBI Official Full Name
claudin-14
NCBI Official Synonym Full Names
claudin 14
NCBI Official Symbol
CLDN14
NCBI Official Synonym Symbols
DFNB29
NCBI Protein Information
claudin-14
Protein Family

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. It is also reported that four synonymous variants in this gene are associated with kidney stones and reduced bone mineral density. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]

Research Articles on CLDN14

Similar Products

Product Notes

The CLDN14 (Catalog #AAA6151838) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLDN14 (Claudin-14, UNQ777/PRO1571) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLDN14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLDN14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.