Mouse anti-Human CKMT1A Monoclonal Antibody | anti-CKMT1A antibody

CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (PE)

Cat. Num. AAA6157131

• Gene Names: CKMT1B; CKMT; CKMT1; UMTCK
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CKMT1A; Monoclonal Antibody; CKMT1A (Creatine Kinase U-type; Mitochondrial; Ubiquitous Mitochondrial Creatine Kinase; U-MtCK; Acidic-type Mitochondrial Creatine Kinase; Mia-CK; CKMT; CKMT1B; CKMT) (PE); anti-CKMT1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C8
• Specificity: Recognizes human CKMT1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CKMT1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa327-417 from human CKMT1B (NP_066270) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(CKMT1B monoclonal antibody. Western Blot analysis of CKMT1B expression in A-431.)

Western Blot (WB)

(Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody. Lane 1: CKMT1B transfected lysate (47kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CKMT1B is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-CKMT1A antibody

Antibodies; Enzymes; Creatine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 10334859
• NCBI GeneID: 1159
• NCBI Accession #: NP_066270
• NCBI GenBank Nucleotide #: NM_020990
• Molecular Weight: 50,421 Da
• NCBI Official Full Name: creatine kinase U-type, mitochondrial
• NCBI Official Synonym Full Names: creatine kinase, mitochondrial 1B
• NCBI Official Symbol: CKMT1B
• NCBI Official Synonym Symbols: CKMT; CKMT1; UMTCK
• NCBI Protein Information: creatine kinase U-type, mitochondrial

NCBI Description

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq, Jul 2008]