Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Mouse anti-Human CKMT1A Monoclonal Antibody | anti-CKMT1A antibody

CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) APC

Gene Names
CKMT1B; CKMT; CKMT1; UMTCK
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CKMT1A; Monoclonal Antibody; CKMT1A (Creatine Kinase U-type; Mitochondrial; Ubiquitous Mitochondrial Creatine Kinase; U-MtCK; Acidic-type Mitochondrial Creatine Kinase; Mia-CK; CKMT; CKMT1B; CKMT) APC; anti-CKMT1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C8
Specificity
Recognizes human CKMT1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CKMT1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa327-417 from human CKMT1B (NP_066270) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(CKMT1B monoclonal antibody. Western Blot analysis of CKMT1B expression in A-431.)

Western Blot (WB) (CKMT1B monoclonal antibody. Western Blot analysis of CKMT1B expression in A-431.)

Western Blot (WB)

(Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody. Lane 1: CKMT1B transfected lysate (47kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody. Lane 1: CKMT1B transfected lysate (47kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CKMT1B is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CKMT1B is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-CKMT1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,421 Da
NCBI Official Full Name
creatine kinase U-type, mitochondrial
NCBI Official Synonym Full Names
creatine kinase, mitochondrial 1B
NCBI Official Symbol
CKMT1B
NCBI Official Synonym Symbols
CKMT; CKMT1; UMTCK
NCBI Protein Information
creatine kinase U-type, mitochondrial

NCBI Description

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq, Jul 2008]

Research Articles on CKMT1A

Similar Products

Product Notes

The CKMT1A (Catalog #AAA6135919) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CKMT1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CKMT1A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CKMT1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.