Mouse anti-Human CIDE-3 Monoclonal Antibody | anti-CIDE-3 antibody

CIDE-3 (CIDEC, Cell Death Activator CIDE-3, Cell Death-inducing DFFA-like Effector Protein C, Fat-specific Protein FSP27 Homolog, FSP27) (HRP)

Cat. Num. AAA6151814

• Gene Names: CIDEC; FSP27; CIDE-3; FLJ20871
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CIDE-3; Monoclonal Antibody; CIDE-3 (CIDEC; Cell Death Activator CIDE-3; Cell Death-inducing DFFA-like Effector Protein C; Fat-specific Protein FSP27 Homolog; FSP27) (HRP); anti-CIDE-3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E2
• Specificity: Recognizes human CIDEC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CIDE-3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa53-142 from human CIDEC (NP_071377) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Testing Data

(Detection limit for recombinant GST tagged CIDEC is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-CIDE-3 antibody

DNA fragmentation is one of the critical steps in apoptosis, which is induced by DNA fragmentation factor (DFF). DFF is composed of two subunits, a 40kD caspase-activated nuclease (DFF40) and a 45kD inhibitor (DFF45). Recently a novel family of cell-death-inducing DFF45-like effectors (CIDEs) has been identified. Human CIDE-3 is a novel member of CIDEs. There are 2 transcripts, CIDE-3 and CIDE-3alpha, were present in HepG2 and A375 cells. Consistent with its chromosome localization at 3p25, a region associated with high frequency loss of heterozygosity in many tumors, CIDE-3 may play an important role in prevention of tumorigenesis.

Product Categories/Family for anti-CIDE-3 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 23943904
• NCBI GeneID: 63924
• NCBI Accession #: NP_071377.2
• NCBI GenBank Nucleotide #: NM_022094
• UniProt Accession #: Q96AQ7; Q67DW9; Q9GZY9
• Molecular Weight: 26,754 Da
• NCBI Official Full Name: cell death activator CIDE-3 isoform 3
• NCBI Official Synonym Full Names: cell death-inducing DFFA-like effector c
• NCBI Official Symbol: CIDEC
• NCBI Official Synonym Symbols: FSP27; CIDE-3; FLJ20871
• NCBI Protein Information: cell death activator CIDE-3; OTTHUMP00000158645; OTTHUMP00000207602; fat specific protein 27
• UniProt Protein Name: Cell death activator CIDE-3
• UniProt Gene Name: CIDEC
• UniProt Synonym Gene Names: FSP27
• UniProt Entry Name: CIDEC_HUMAN

NCBI Description

This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq]

Uniprot Description

CIDEC: May act as a CEBPB coactivator in white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. In omental adipose tissue of obese patients matched for BMI, expression levels tend to correlate with insulin sensitivity. Expression is increased 2-3 fold in the group of patients with high insulin sensitivity, compared to the insulin- resistant group. This observation is consistent with the idea that triglyceride storage in adipocytes plays an important role in sequestering triglycerides and fatty acids away from the circulation and peripheral tissues, thus enhancing insulin sensitivity in liver and muscle. This effect is not significant in subcutaneous adipose tissue (PubMed:18509062). In subcutaneous adipose tissue of diabetic patients, tends to negatively correlate with body mass index and total fat mass, independently of insulin sensitivity (PubMed:18334488). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: cytosol; lipid particle

Biological Process: apoptosis; regulation of apoptosis

Disease: Lipodystrophy, Familial Partial, Type 5