Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CHST4 is ~3ng/ml as a capture antibody.)

Mouse anti-Human CHST4 Monoclonal Antibody | anti-CHST4 antibody

CHST4 (Carbohydrate Sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GST-3, High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase, HEC-GlcNAc6ST, L-selectin Ligand Sulfotransferase, LSST, N-acetylgluc

Gene Names
CHST4; GST3; LSST; GlcNAc6ST2; HECGLCNAC6ST
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHST4; Monoclonal Antibody; CHST4 (Carbohydrate Sulfotransferase 4; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; GST-3; High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase; HEC-GlcNAc6ST; L-selectin Ligand Sulfotransferase; LSST; N-acetylgluc; anti-CHST4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D7
Specificity
Recognizes human CHST4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2145
Applicable Applications for anti-CHST4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa221-320 from CHST4 (NP_005760) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CHST4 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHST4 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-CHST4 antibody
Catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within mucin-associated glycans that ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X on L-selectin counter receptors CD43, GlyCAM-1 and MAdCAM-1. Also involved in biosynthesis of L-selectin ligand recognized by MECA-79 antibody. Plays a central role in lymphocyte trafficking during chronic inflammation. Has a catalytic preference for core 2-branched mucin-type O-glycans. Can use GlcNAcbeta1-6[Galbeta1-3]GalNAc-pNP (core 2), GlcNAcbeta1-6ManOMe and GlcNAcbeta1-2Man oligosaccharide structures as acceptors. Has also activity toward core 3 of GlcNAcbeta1-3GalNAc-pNP. Its substrate specificity may be influenced by its subcellular location.
Product Categories/Family for anti-CHST4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens carbohydrate sulfotransferase 4 (CHST4), transcript variant 1, mRNA
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 4
NCBI Official Symbol
CHST4
NCBI Official Synonym Symbols
GST3; LSST; GlcNAc6ST2; HECGLCNAC6ST
NCBI Protein Information
carbohydrate sulfotransferase 4
UniProt Protein Name
Carbohydrate sulfotransferase 4
UniProt Gene Name
CHST4
UniProt Synonym Gene Names
GST-3; HEC-GlcNAc6ST; LSST; GlcNAc6ST-2; Gn6st-2

NCBI Description

This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is involved in the modification of glycan structures on ligands of the lymphocyte homing receptor L-selectin. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2009]

Uniprot Description

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within mucin-associated glycans that ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of the SELL ligand sialyl 6-sulfo Lewis X on receptors SPN/CD43, GLYCAM1 and MADCAM1. Also involved in biosynthesis of SELL ligand recognized by MECA-79 antibody. Plays a central role in lymphocyte trafficking during chronic inflammation. Has a catalytic preference for core 2-branched mucin-type O-glycans. Can use GlcNAcbeta1-6[Galbeta1-3]GalNAc-pNP (core 2), GlcNAcbeta1-6ManOMe and GlcNAcbeta1-2Man oligosaccharide structures as acceptors. Has also activity toward core 3 of GlcNAcbeta1-3GalNAc-pNP. Its substrate specificity may be influenced by its subcellular location.

Research Articles on CHST4

Similar Products

Product Notes

The CHST4 chst4 (Catalog #AAA6146505) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHST4 (Carbohydrate Sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GST-3, High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase, HEC-GlcNAc6ST, L-selectin Ligand Sulfotransferase, LSST, N-acetylgluc reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHST4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHST4 chst4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHST4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.