Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CENPA Monoclonal Antibody | anti-CENPA antibody

CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A) (MaxLight 405)

Gene Names
CENPA; CenH3; CENP-A
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CENPA; Monoclonal Antibody; CENPA (Histone H3-like Centromeric Protein A; Centromere Autoantigen A; Centromere Protein A; CENP-A) (MaxLight 405); anti-CENPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D4-1A3
Specificity
Recognizes human CENPA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CENPA antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-114 from human CENPA (AAH00881) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CENPA antibody
Centromere protein A (CENP-A) is a centromere-specific histone variant which forms an octameric complex with Histones H4, H2A, and H2B, in the presence of DNA. CENP-A defines active centromere regions by forming centromere-specific nucleosomes on which kinetochores are assembled. CENP-A is specifically located to the inner plate of the kinetochore and it is essential for kinetochore targeting of CENP-C and other kinetochore components. CENP-A is required for nucleosomal packaging of centromeric DNA at interphase.
Product Categories/Family for anti-CENPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
13,001 Da
NCBI Official Full Name
Homo sapiens centromere protein A, mRNA
NCBI Official Synonym Full Names
centromere protein A
NCBI Official Symbol
CENPA
NCBI Official Synonym Symbols
CenH3; CENP-A
NCBI Protein Information
histone H3-like centromeric protein A

NCBI Description

Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]

Research Articles on CENPA

Similar Products

Product Notes

The CENPA (Catalog #AAA6189406) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CENPA can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CENPA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CENPA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.