Mouse anti-Human CENPA Monoclonal Antibody | anti-CENPA antibody

CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A) (Biotin)

Cat. Num. AAA6141149

• Gene Names: CENPA; CenH3; CENP-A
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CENPA; Monoclonal Antibody; CENPA (Histone H3-like Centromeric Protein A; Centromere Autoantigen A; Centromere Protein A; CENP-A) (Biotin); anti-CENPA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D4-1A3
• Specificity: Recognizes human CENPA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CENPA antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-114 from human CENPA (AAH00881) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CENPA is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-CENPA antibody

Centromere protein A (CENP-A) is a centromere-specific histone variant which forms an octameric complex with Histones H4, H2A, and H2B, in the presence of DNA. CENP-A defines active centromere regions by forming centromere-specific nucleosomes on which kinetochores are assembled. CENP-A is specifically located to the inner plate of the kinetochore and it is essential for kinetochore targeting of CENP-C and other kinetochore components. CENP-A is required for nucleosomal packaging of centromeric DNA at interphase.

Product Categories/Family for anti-CENPA antibody

Antibodies; Centromeres

NCBI and Uniprot Product Information

• NCBI GI #: 12654132
• NCBI GeneID: 1058
• Molecular Weight: 13,001 Da
• NCBI Official Full Name: Homo sapiens centromere protein A, mRNA
• NCBI Official Synonym Full Names: centromere protein A
• NCBI Official Symbol: CENPA
• NCBI Official Synonym Symbols: CenH3; CENP-A
• NCBI Protein Information: histone H3-like centromeric protein A
• Protein Family: Histone H3-like centromeric protein

NCBI Description

Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]