Rabbit Perilipin 3 Polyclonal Antibody | anti-PLIN3 antibody

Anti-Perilipin 3 Antibody

Cat. Num. AAA178513

• Gene Names: PLIN3; PP17; TIP47; M6PRBP1
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: Perilipin 3; Polyclonal Antibody; Anti-Perilipin 3 Antibody; M6PRBP 1; M6PRBP1; Perilipin3; Perilipin-3; PLIN3; pp17; Placental protein 17; TIP47; O60664; perilipin 3; anti-PLIN3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 433

• Applicable Applications for anti-PLIN3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat; Immunohistochemisry Paraffin: 0.5-1mug/ml; Tested Species: Human; Tested Species:In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Perilipin 3 expression in rat liver extract (lane 1), mouse kidney extract (lane 2) and HELA whole cell lysates (lane 3). Perilipin 3 at 47KD was detected using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(Perilipin 3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-PLIN3 antibody

Rabbit IgG polyclonal antibody for Perilipin-3 (PLIN3) detection.
Background: Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

References

1. "Entrez Gene: M6PRBP1 mannose-6-phosphate receptor binding protein 1".
2. Bulankina AV, Deggerich A, Wenzel D, Mutenda K, Wittmann JG, Rudolph MG, Burger KN, Höning S (May 2009)."TIP47 functions in the biogenesis of lipid droplets". J. Cell Biol. 185 (4): 641-55.
3. Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR. (May 2001). "Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.". Science 292(5520): 1373-6.

NCBI and Uniprot Product Information

• NCBI GI #: 255958289
• NCBI GeneID: 10226
• NCBI Accession #: NP_001157661.1
• NCBI GenBank Nucleotide #: NM_001164189.1
• UniProt Accession #: O60664; Q53G77; Q9BS03; Q9UBD7; Q9UP92; A8K4Y9; K7EQF4
• Molecular Weight: 45,803 Da
• NCBI Official Full Name: perilipin-3 isoform 2
• NCBI Official Synonym Full Names: perilipin 3
• NCBI Official Symbol: PLIN3
• NCBI Official Synonym Symbols: PP17; TIP47; M6PRBP1
• NCBI Protein Information: perilipin-3
• UniProt Protein Name: Perilipin-3
• Protein Family: Perilipin
• UniProt Gene Name: PLIN3
• UniProt Synonym Gene Names: M6PRBP1; TIP47; 47 kDa MPR-binding protein; PP17
• UniProt Entry Name: PLIN3_HUMAN

NCBI Description

Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2009]

Uniprot Description

perilipin 3: a membrane-associated protein and a coat protein for lipid droplets (LDs). It has been described as a mannose-6-phosphate receptor (MPR) binding protein required for endosome-to-Golgi transport of MPRs, but this function has been disputed. Interacts with M6PR and IGF2R via their cytoplasmic domains. Affects hepatic lipid and glucose metabolism. Belongs to the perilipin family. 3 isoforms of the human protein are produced by alternative splicing. Isoform 2 may exist as a homodimer known as PP17C.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoplasm; cytosol; endosome; Golgi apparatus; intracellular membrane-bound organelle; lipid particle; membrane; transport vesicle

Molecular Function: protein binding

Biological Process: vesicle-mediated transport