Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDK9 Monoclonal Antibody | anti-CDK9 antibody

CDK9 (Cyclin-dependent Kinase 9, C-2K, Cell Division Cycle 2-like Protein Kinase 4, Cell Division Protein Kinase 9, Serine/Threonine-protein Kinase PITALRE, CDC2L4) (MaxLight 650)

Gene Names
CDK9; TAK; C-2k; CTK1; CDC2L4; PITALRE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK9; Monoclonal Antibody; CDK9 (Cyclin-dependent Kinase 9; C-2K; Cell Division Cycle 2-like Protein Kinase 4; Cell Division Protein Kinase 9; Serine/Threonine-protein Kinase PITALRE; CDC2L4) (MaxLight 650); anti-CDK9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Specificity
Recognizes human CDK9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CDK9 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-372 from human CDK9 (AAH01968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDK9 antibody
CDK9 (cyclin-dependent kinase 9, serine/threonine-protein kinase PITALRE) is a member of the cell division cycle 2 (CDC2) family of kinases that play a pivotal role in the regulation of the eukaryotic cell cycle. CDK9 expression is ubiquitous, but its expression levels are different in various human tissues. CDK9 is localized primarily to the nucleus. At pathophysiological levels, CDK9 activity suppresses many genes for mitochondrial proteins including master regulators of mitochondrial function (peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1), nuclear respiratory factor-1). Chronic activation of CDK9 causes not only cardiomyocyte enlargement but also defective mitochondrial function. The cyclinT/CDK9 complex, also called positive transcription elongation factor b (p-TEFb), phosphorylates the C-terminal domain of the large subunit of RNA polymerase II, stimulating transcription elongation and pre-mRNA processing.
Product Categories/Family for anti-CDK9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
53,365 Da
NCBI Official Full Name
Homo sapiens cyclin-dependent kinase 9, mRNA
NCBI Official Synonym Full Names
cyclin dependent kinase 9
NCBI Official Symbol
CDK9
NCBI Official Synonym Symbols
TAK; C-2k; CTK1; CDC2L4; PITALRE
NCBI Protein Information
cyclin-dependent kinase 9
Protein Family

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. [provided by RefSeq, Jul 2008]

Research Articles on CDK9

Similar Products

Product Notes

The CDK9 (Catalog #AAA6221405) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDK9 (Cyclin-dependent Kinase 9, C-2K, Cell Division Cycle 2-like Protein Kinase 4, Cell Division Protein Kinase 9, Serine/Threonine-protein Kinase PITALRE, CDC2L4) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.