Mouse anti-Human CDK9 Monoclonal Antibody | anti-CDK9 antibody

CDK9 (Cyclin-dependent Kinase 9, C-2K, Cell Division Cycle 2-like Protein Kinase 4, Cell Division Protein Kinase 9, Serine/Threonine-protein Kinase PITALRE, CDC2L4) APC

Cat. Num. AAA6135820

• Gene Names: CDK9; TAK; C-2k; CTK1; CDC2L4; PITALRE
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDK9; Monoclonal Antibody; CDK9 (Cyclin-dependent Kinase 9; C-2K; Cell Division Cycle 2-like Protein Kinase 4; Cell Division Protein Kinase 9; Serine/Threonine-protein Kinase PITALRE; CDC2L4) APC; anti-CDK9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D7
• Specificity: Recognizes human CDK9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CDK9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa271-372 from human CDK9 (AAH01968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(Western Blot analysis of CDK9 expression in transfected 293T cell line by CDK9 monoclonal antibody. Lane 1: CDK9 transfected lysate (42.778kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CDK9 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CDK9 antibody

CDK9 (cyclin-dependent kinase 9, serine/threonine-protein kinase PITALRE) is a member of the cell division cycle 2 (CDC2) family of kinases that play a pivotal role in the regulation of the eukaryotic cell cycle. CDK9 expression is ubiquitous, but its expression levels are different in various human tissues. CDK9 is localized primarily to the nucleus. At pathophysiological levels, CDK9 activity suppresses many genes for mitochondrial proteins including master regulators of mitochondrial function (peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-1), nuclear respiratory factor-1). Chronic activation of CDK9 causes not only cardiomyocyte enlargement but also defective mitochondrial function. The cyclinT/CDK9 complex, also called positive transcription elongation factor b (p-TEFb), phosphorylates the C-terminal domain of the large subunit of RNA polymerase II, stimulating transcription elongation and pre-mRNA processing.

Product Categories/Family for anti-CDK9 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 12805028
• NCBI GeneID: 1025
• Molecular Weight: 53,365 Da
• NCBI Official Full Name: Homo sapiens cyclin-dependent kinase 9, mRNA
• NCBI Official Synonym Full Names: cyclin dependent kinase 9
• NCBI Official Symbol: CDK9
• NCBI Official Synonym Symbols: TAK; C-2k; CTK1; CDC2L4; PITALRE
• NCBI Protein Information: cyclin-dependent kinase 9
• Protein Family: Cyclin-dependent kinase

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kinase was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. [provided by RefSeq, Jul 2008]