Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (38.21kD).)

Mouse anti-Human CDH19 Monoclonal Antibody | anti-CDH19 antibody

CDH19 (Cadherin-19, CDH7L2, UNQ478/PRO941) (FITC)

Gene Names
CDH19; CDH7; CDH7L2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDH19; Monoclonal Antibody; CDH19 (Cadherin-19; CDH7L2; UNQ478/PRO941) (FITC); anti-CDH19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G4
Specificity
Recognizes human CDH19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
6297
Applicable Applications for anti-CDH19 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa231-340 from human CDH19 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHH*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against immunogen (38.21kD).)

Testing Data

(Detection limit for 124771 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for 124771 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CDH19 antibody
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Product Categories/Family for anti-CDH19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens cadherin 19 (CDH19), transcript variant 1, mRNA
NCBI Official Synonym Full Names
cadherin 19
NCBI Official Symbol
CDH19
NCBI Official Synonym Symbols
CDH7; CDH7L2
NCBI Protein Information
cadherin-19
UniProt Protein Name
Cadherin-19
Protein Family
UniProt Gene Name
CDH19
UniProt Synonym Gene Names
CDH7L2
UniProt Entry Name
CAD19_HUMAN

NCBI Description

This gene is one of three related type II cadherin genes situated in a cluster on chromosome 18. The encoded protein is a calcium dependent cell-cell adhesion glycoprotein containing five extracellular cadherin repeats. Loss of cadherins may be associated with cancer formation. Alternative splicing results in multiple transcript variants for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

CDH19: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 18q22.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: calcium ion binding

Biological Process: homophilic cell adhesion

Research Articles on CDH19

Similar Products

Product Notes

The CDH19 cdh19 (Catalog #AAA6146419) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDH19 (Cadherin-19, CDH7L2, UNQ478/PRO941) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDH19 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDH19 cdh19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDH19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.