Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human CRELD2 Monoclonal Antibody | anti-CRELD2 antibody

CRELD2 (Cysteine-rich with EGF-like Domain Protein 2, UNQ185/PRO211, DKFZp667O055, MGC11256)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
CRELD2; Monoclonal Antibody; CRELD2 (Cysteine-rich with EGF-like Domain Protein 2; UNQ185/PRO211; DKFZp667O055; MGC11256); Anti -CRELD2 (Cysteine-rich with EGF-like Domain Protein 2; anti-CRELD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
2B6
Specificity
Recognizes human CRELD2.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE
Applicable Applications for anti-CRELD2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa163-259 from human CRELD2 (NP_077300) with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)
Related Product Information for anti-CRELD2 antibody
CRELD2 may regulate transport of alpha4-beta2 neuronal acetylcholine receptor.
Product Categories/Family for anti-CRELD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,192 Da
NCBI Official Full Name
cysteine-rich with EGF-like domain protein 2 isoform d
NCBI Official Synonym Full Names
cysteine-rich with EGF-like domains 2
NCBI Official Symbol
CRELD2
NCBI Protein Information
cysteine-rich with EGF-like domain protein 2
UniProt Protein Name
Cysteine-rich with EGF-like domain protein 2
UniProt Gene Name
CRELD2
UniProt Entry Name
CREL2_HUMAN

Uniprot Description

CRELD2: May regulate transport of alpha4-beta2 neuronal acetylcholine receptor. Belongs to the CRELD family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q13.33

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum

Molecular Function: protein binding; calcium ion binding

Research Articles on CRELD2

Similar Products

Product Notes

The CRELD2 creld2 (Catalog #AAA6008868) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRELD2 (Cysteine-rich with EGF-like Domain Protein 2, UNQ185/PRO211, DKFZp667O055, MGC11256) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRELD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CRELD2 creld2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GDGSCRCHMG YQGPLCTDCM DGYFSSLRNE THSICTACDE SCKTCSGLTN RDCGECEVGW VLDEGACVDV DECAAEPPPC SAAQFCKNAN GSYTCEE. It is sometimes possible for the material contained within the vial of "CRELD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.