Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.98kD).)

Mouse anti-Human CDC5L Monoclonal Antibody | anti-CDC5L antibody

CDC5L (Cell Division Cycle 5-like Protein, Cdc5-like Protein, Pombe Cdc5-related Protein, KIAA0432, PCDC5RP) (HRP)

Gene Names
CDC5L; CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC5L; Monoclonal Antibody; CDC5L (Cell Division Cycle 5-like Protein; Cdc5-like Protein; Pombe Cdc5-related Protein; KIAA0432; PCDC5RP) (HRP); anti-CDC5L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C12
Specificity
Recognizes human CDC5L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CDC5L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa719-802 from human CDC5L (NP_001244) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.98kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.98kD).)

Western Blot (WB)

(Western Blot analysis of CDC5L expression in transfected 293T cell line by CDC5L monoclonal antibody. Lane 1: CDC5L transfected lysate (92.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CDC5L expression in transfected 293T cell line by CDC5L monoclonal antibody. Lane 1: CDC5L transfected lysate (92.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CDC5L is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDC5L is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CDC5L antibody
DNA-binding protein involved in cell cycle control. May act as a transcription activator. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.
Product Categories/Family for anti-CDC5L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
988
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92,251 Da
NCBI Official Full Name
cell division cycle 5-like protein
NCBI Official Synonym Full Names
cell division cycle 5-like
NCBI Official Symbol
CDC5L
NCBI Official Synonym Symbols
CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1
NCBI Protein Information
cell division cycle 5-like protein; CDC5 cell division cycle 5-like; Cdc5-related protein; dJ319D22.1 (CDC5-like protein); pombe cdc5-related protein
UniProt Protein Name
Cell division cycle 5-like protein
UniProt Gene Name
CDC5L
UniProt Synonym Gene Names
KIAA0432; PCDC5RP; Cdc5-like protein
UniProt Entry Name
CDC5L_HUMAN

Uniprot Description

CDC5L: is a spliceosome protein that binds DNA and that also regulates transcription. Is a positive regulator of cell cycle G2/M progression. Is an essential component of non-snRNA spliceosomes and is required for the second catalytic step of pre-mRNA splicing. Binds adeno-pre-mRNA in an ATP-stimulated manner. Is part of a spliceosomal 'core' complex that includes CDC5L, SF2, PRLI, SPF27, HSP7C, PRPF19/SNEV, GCN1L. Identified in the spliceosome C complex. Has been associated with aneuploidy in aging cells and in tumorigenesis. The genomic region containing the gene for CDC5L (6p21.1) is frequently amplified in osteosarcomas.

Protein type: DNA-binding; RNA processing; Transcription factor; Spliceosome; Motility/polarity/chemotaxis; RNA splicing

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; DNA replication factor A complex; membrane; cytoplasm; nucleolus; nuclear speck; nucleus

Molecular Function: protein binding; DNA binding; chromatin binding

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of transcription, DNA-dependent; RNA splicing; gene expression; DNA repair

Similar Products

Product Notes

The CDC5L cdc5l (Catalog #AAA6151717) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC5L (Cell Division Cycle 5-like Protein, Cdc5-like Protein, Pombe Cdc5-related Protein, KIAA0432, PCDC5RP) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC5L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC5L cdc5l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC5L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.