Mouse anti-Human CDC5L Monoclonal Antibody | anti-CDC5L antibody

CDC5L (Cell Division Cycle 5-like Protein, Cdc5-like Protein, Pombe Cdc5-related Protein, KIAA0432, PCDC5RP) (FITC)

Cat. Num. AAA6146414

• Gene Names: CDC5L; CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDC5L; Monoclonal Antibody; CDC5L (Cell Division Cycle 5-like Protein; Cdc5-like Protein; Pombe Cdc5-related Protein; KIAA0432; PCDC5RP) (FITC); anti-CDC5L antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C12
• Specificity: Recognizes human CDC5L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CDC5L antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa719-802 from human CDC5L (NP_001244) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.98kD).)

Western Blot (WB)

(Western Blot analysis of CDC5L expression in transfected 293T cell line by CDC5L monoclonal antibody. Lane 1: CDC5L transfected lysate (92.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CDC5L is ~1ng/ml as a capture antibody.)

Related Product Information for anti-CDC5L antibody

DNA-binding protein involved in cell cycle control. May act as a transcription activator. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.

Product Categories/Family for anti-CDC5L antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 11067747
• NCBI GeneID: 988
• NCBI Accession #: NP_001244
• NCBI GenBank Nucleotide #: NM_001253
• UniProt Accession #: Q99459; Q76N46; Q99974
• Molecular Weight: 92,251 Da
• NCBI Official Full Name: cell division cycle 5-like protein
• NCBI Official Synonym Full Names: cell division cycle 5-like
• NCBI Official Symbol: CDC5L
• NCBI Official Synonym Symbols: CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1
• NCBI Protein Information: cell division cycle 5-like protein; CDC5 cell division cycle 5-like; Cdc5-related protein; dJ319D22.1 (CDC5-like protein); pombe cdc5-related protein
• UniProt Protein Name: Cell division cycle 5-like protein
• Protein Family: Cell division cycle 5-like protein
• UniProt Gene Name: CDC5L
• UniProt Synonym Gene Names: KIAA0432; PCDC5RP; Cdc5-like protein
• UniProt Entry Name: CDC5L_HUMAN

Uniprot Description

CDC5L: is a spliceosome protein that binds DNA and that also regulates transcription. Is a positive regulator of cell cycle G2/M progression. Is an essential component of non-snRNA spliceosomes and is required for the second catalytic step of pre-mRNA splicing. Binds adeno-pre-mRNA in an ATP-stimulated manner. Is part of a spliceosomal 'core' complex that includes CDC5L, SF2, PRLI, SPF27, HSP7C, PRPF19/SNEV, GCN1L. Identified in the spliceosome C complex. Has been associated with aneuploidy in aging cells and in tumorigenesis. The genomic region containing the gene for CDC5L (6p21.1) is frequently amplified in osteosarcomas.

Protein type: DNA-binding; RNA processing; Transcription factor; Spliceosome; Motility/polarity/chemotaxis; RNA splicing

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; DNA replication factor A complex; membrane; cytoplasm; nucleolus; nuclear speck; nucleus

Molecular Function: protein binding; DNA binding; chromatin binding

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of transcription, DNA-dependent; RNA splicing; gene expression; DNA repair