Mouse anti-Human CD93 Monoclonal Antibody | anti-CD93 antibody

CD93 (Complement Component C1Q Receptor, C1q/MBL/SPA Receptor, C1qR, C1qR(p), C1qRp, CDw93, Complement Component 1 q Subcomponent Receptor 1, Matrix-remodeling-associated Protein 4, C1QR1, MXRA4) (Biotin)

Cat. Num. AAA6141089

• Gene Names: CD93; C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD93; Monoclonal Antibody; CD93 (Complement Component C1Q Receptor; C1q/MBL/SPA Receptor; C1qR; C1qR(p); C1qRp; CDw93; Complement Component 1 q Subcomponent Receptor 1; Matrix-remodeling-associated Protein 4; C1QR1; MXRA4) (Biotin); anti-CD93 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3, lambda
• Clone Number: 3D12
• Specificity: Recognizes human C1QR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 6681

• Applicable Applications for anti-CD93 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-141 from C1QR1 (NP_036204) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Testing Data

(Detection limit for recombinant GST tagged C1QR1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-CD93 antibody

CD93 is a 110kD O-sialoglycoprotein, known as complement C1q receptor, C1qR1, C1qRp (C1q receptor precursor), or GR11. It is expression on monocytes, granulocytes, platelets, and endothelial cells. CD93 regulates phagocytosis of apoptosis cells, and leukocyte-endothelial cell adhesion.

Product Categories/Family for anti-CD93 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 1519312210
• NCBI GeneID: 22918
• NCBI Accession #: NM_012072.4
• NCBI GenBank Nucleotide #: NM_012072
• UniProt Accession #: Q9NPY3
• NCBI Official Full Name: Homo sapiens CD93 molecule (CD93), mRNA
• NCBI Official Synonym Full Names: CD93 molecule
• NCBI Official Symbol: CD93
• NCBI Official Synonym Symbols: C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1
• NCBI Protein Information: complement component C1q receptor
• UniProt Protein Name: Complement component C1q receptor
• Protein Family: Complement component C1q receptor
• UniProt Gene Name: CD93
• UniProt Synonym Gene Names: C1QR1; MXRA4; C1qR; C1qR(p); C1qRp
• UniProt Entry Name: C1QR1_HUMAN

NCBI Description

The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq, Jul 2008]