Mouse anti-Human CD7 Monoclonal Antibody | anti-CD7 antibody

CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (PE)

Cat. Num. AAA6156986

• Gene Names: CD7; GP40; TP41; Tp40; LEU-9
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD7; Monoclonal Antibody; CD7 (T-cell Antigen CD7; GP40; T-cell Leukemia Antigen; T-cell Surface Antigen Leu-9; TP41) (PE); anti-CD7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B8
• Specificity: Recognizes human CD7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CD7 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa21-240 from human CD7 (AAH09293) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.94kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of CD7 transfected lysate using CD7 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CD7 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CD7 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-CD7 antibody

CD7, a 40kD transmembrane glycoprotein, is a novel member of Ig superfamily expressed primarily on thymocytes and mature T-cells. It consists of a extracellullar region with Ig-like domains, a transmembrane region and cytoplasmic tail. It functions as a co-stimulatory molecule regulating the function and development of T-cells and NK cells. It plays a significant role in T-cell interactions and also in T-cell/B-cell interactions during early lymphoid development. Reports suggest CD7 has a key role in regulating integrin-mediated adhesion of T-cells.

Product Categories/Family for anti-CD7 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 33872968
• NCBI GeneID: 924
• Molecular Weight: 25,409 Da
• NCBI Official Full Name: Homo sapiens CD7 molecule, mRNA
• NCBI Official Synonym Full Names: CD7 molecule
• NCBI Official Symbol: CD7
• NCBI Official Synonym Symbols: GP40; TP41; Tp40; LEU-9
• NCBI Protein Information: T-cell antigen CD7
• Protein Family: CD70 antigen

NCBI Description

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]