Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD7 expression in transfected 293T cell line by CD7 polyclonal antibody. Lane 1: CD7 transfected lysate (25.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CD7 Polyclonal Antibody | anti-CD7 antibody

CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (Biotin)

Gene Names
CD7; GP40; TP41; Tp40; LEU-9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD7; Polyclonal Antibody; CD7 (T-cell Antigen CD7; GP40; T-cell Leukemia Antigen; T-cell Surface Antigen Leu-9; TP41) (Biotin); anti-CD7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD7, aa1-240 (NP_006128.1).
Immunogen Sequence
MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD7 expression in transfected 293T cell line by CD7 polyclonal antibody. Lane 1: CD7 transfected lysate (25.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD7 expression in transfected 293T cell line by CD7 polyclonal antibody. Lane 1: CD7 transfected lysate (25.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD7 antibody
CD7, a 40kD transmembrane glycoprotein, is a novel member of Ig superfamily expressed primarily on thymocytes and mature T-cells. It consists of a extracellullar region with Ig-like domains, a transmembrane region and cytoplasmic tail. It functions as a co-stimulatory molecule regulating the function and development of T-cells and NK cells. It plays a significant role in T-cell interactions and also in T-cell/B-cell interactions during early lymphoid development. Reports suggest CD7 has a key role in regulating integrin-mediated adhesion of T-cells.
Product Categories/Family for anti-CD7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
924
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,409 Da
NCBI Official Full Name
T-cell antigen CD7
NCBI Official Synonym Full Names
CD7 molecule
NCBI Official Symbol
CD7
NCBI Official Synonym Symbols
GP40; TP41; Tp40; LEU-9
NCBI Protein Information
T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
UniProt Protein Name
T-cell antigen CD7
Protein Family
UniProt Gene Name
CD7
UniProt Entry Name
CD7_HUMAN

NCBI Description

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]

Uniprot Description

CD7: Not yet known.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 17q25.2-q25.3

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: receptor activity

Biological Process: T cell activation; homeostasis of number of cells within a tissue; immune response; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on CD7

Similar Products

Product Notes

The CD7 cd7 (Catalog #AAA6373248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD7 cd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.