Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CASP3 is ~1ng/ml as a capture antibody)

Mouse anti-Human Caspase 3 Monoclonal Antibody | anti-CASP3 antibody

Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, Protein Yama, SREBP Cleavage Activity 1, SCA-1) (AP)

Gene Names
CASP3; CPP32; SCA-1; CPP32B
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Caspase 3; Monoclonal Antibody; Caspase 3 (Caspase-3; CASP3; CASP-3; Apopain; Cysteine Protease CPP32; CPP32; CPP-32; CPP32B; Protein Yama; SREBP Cleavage Activity 1; SCA-1) (AP); anti-CASP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D3
Specificity
Recognizes human CASP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CASP3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa176-277 from human CASP3 (AAH16926.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CASP3 is ~1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged CASP3 is ~1ng/ml as a capture antibody)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP6 and CASP3. HeLa cells were stained with CASP6 rabbit purified polyclonal 1:1200 and CASP3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP6 and CASP3. HeLa cells were stained with CASP6 rabbit purified polyclonal 1:1200 and CASP3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CASP3 antibody
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family and is a downstream effector cysteine protease in the apoptotic pathway. It is made of two subunits, p20 and p11, which form the active complex. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is related to mammalian interleukin-1 converting enzyme (ICE) and to its Caenorhabditis elegans homologue, CED-3. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. It is ubiquitously expressed in normal Human tissues including the liver, spleen, heart, liver and kidney.
Product Categories/Family for anti-CASP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
836
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,608 Da
NCBI Official Full Name
Caspase 3, apoptosis-related cysteine peptidase
NCBI Official Synonym Full Names
caspase 3, apoptosis-related cysteine peptidase
NCBI Official Symbol
CASP3
NCBI Official Synonym Symbols
CPP32; SCA-1; CPP32B
NCBI Protein Information
caspase-3; CASP-3; CPP-32; apopain; procaspase3; protein Yama; PARP cleavage protease; cysteine protease CPP32; SREBP cleavage activity 1; caspase 3, apoptosis-related cysteine protease
Protein Family

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]

Research Articles on CASP3

Similar Products

Product Notes

The CASP3 (Catalog #AAA6130372) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, Protein Yama, SREBP Cleavage Activity 1, SCA-1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CASP3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Caspase 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.