Mouse anti-Human Caspase 3 Monoclonal Antibody | anti-CASP3 antibody

Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, Protein Yama, SREBP Cleavage Activity 1, SCA-1) APC

Cat. Num. AAA6135675

• Gene Names: CASP3; CPP32; SCA-1; CPP32B
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Caspase 3; Monoclonal Antibody; Caspase 3 (Caspase-3; CASP3; CASP-3; Apopain; Cysteine Protease CPP32; CPP32; CPP-32; CPP32B; Protein Yama; SREBP Cleavage Activity 1; SCA-1) APC; anti-CASP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D3
• Specificity: Recognizes human CASP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CASP3 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa176-277 from human CASP3 (AAH16926.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CASP3 is ~1ng/ml as a capture antibody)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP6 and CASP3. HeLa cells were stained with CASP6 rabbit purified polyclonal 1:1200 and CASP3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-CASP3 antibody

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family and is a downstream effector cysteine protease in the apoptotic pathway. It is made of two subunits, p20 and p11, which form the active complex. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is related to mammalian interleukin-1 converting enzyme (ICE) and to its Caenorhabditis elegans homologue, CED-3. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. It is ubiquitously expressed in normal Human tissues including the liver, spleen, heart, liver and kidney.

Product Categories/Family for anti-CASP3 antibody

Antibodies; Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 16877344
• NCBI GeneID: 836
• NCBI Accession #: AAH16926.1
• NCBI GenBank Nucleotide #: NM_004346
• Molecular Weight: 31,608 Da
• NCBI Official Full Name: Caspase 3, apoptosis-related cysteine peptidase
• NCBI Official Synonym Full Names: caspase 3, apoptosis-related cysteine peptidase
• NCBI Official Symbol: CASP3
• NCBI Official Synonym Symbols: CPP32; SCA-1; CPP32B
• NCBI Protein Information: caspase-3; CASP-3; CPP-32; apopain; procaspase3; protein Yama; PARP cleavage protease; cysteine protease CPP32; SREBP cleavage activity 1; caspase 3, apoptosis-related cysteine protease
• Protein Family: Caspase

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]