Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CARD14 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human CARD14 Monoclonal Antibody | anti-CARD14 antibody

CARD14 (Caspase Recruitment Domain-containing Protein 14, CARD-containing MAGUK Protein 2, Carma 2, CARMA2) (Biotin)

Gene Names
CARD14; PRP; PSS1; BIMP2; CARMA2; PSORS2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CARD14; Monoclonal Antibody; CARD14 (Caspase Recruitment Domain-containing Protein 14; CARD-containing MAGUK Protein 2; Carma 2; CARMA2) (Biotin); anti-CARD14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B3
Specificity
Recognizes human CARD14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CARD14 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa905-1005 from human CARD14 (NP_077015) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CARD14 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CARD14 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-CARD14 antibody
CARD (caspase recruitment domain) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. CARD belongs to the membrane-associated guanylate kinase (MAGUK) family and activates nuclear factor-Kappa-B through BCL10. The family members show differences in tissue expression.
Product Categories/Family for anti-CARD14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,505 Da
NCBI Official Full Name
caspase recruitment domain-containing protein 14 isoform 1
NCBI Official Synonym Full Names
caspase recruitment domain family, member 14
NCBI Official Symbol
CARD14
NCBI Official Synonym Symbols
PRP; PSS1; BIMP2; CARMA2; PSORS2
NCBI Protein Information
caspase recruitment domain-containing protein 14; CARD-containing MAGUK protein 2; bcl10-interacting maguk protein 2
UniProt Protein Name
Caspase recruitment domain-containing protein 14
UniProt Gene Name
CARD14
UniProt Synonym Gene Names
CARMA2; Carma 2
UniProt Entry Name
CAR14_HUMAN

NCBI Description

This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellular processes including cellular adhesion, signal transduction and cell polarity control. This protein has been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]

Uniprot Description

CARD14: a protein containing a caspase recruitment domain (CARD) that functions as an activator of BCL10 and NF-kappaB signaling. CARD is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in signaling through highly specific protein-protein homophilic interactions. CARD proteins function as scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. The CARD domain of CARD14 associates specifically with the CARD domains of CARD10 and BCL10, a signaling protein that activates NF-kB through the IkappaB kinase complex in response to upstream stimuli. When expressed in cells, CARD14 activates NF-kappaB and induces the phosphorylation of BCL10. A subgroup of primary lymphomas of the central nervous system have higher levels of CARD14 expression.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: cytoplasm; plasma membrane

Molecular Function: CARD domain binding

Biological Process: tumor necrosis factor-mediated signaling pathway; apoptosis; activation of NF-kappaB-inducing kinase; positive regulation of protein amino acid phosphorylation; negative regulation of apoptosis; activation of NF-kappaB transcription factor

Disease: Psoriasis 2; Pityriasis Rubra Pilaris

Research Articles on CARD14

Similar Products

Product Notes

The CARD14 card14 (Catalog #AAA6140968) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CARD14 (Caspase Recruitment Domain-containing Protein 14, CARD-containing MAGUK Protein 2, Carma 2, CARMA2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CARD14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CARD14 card14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CARD14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.