Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CACNA1I is 0.1 ng/ml as a capture antibody.)

Mouse CACNA1I Monoclonal Antibody | anti-CACNA1I antibody

CACNA1I (Calcium Channel, Voltage-Dependent, T Type, alpha 1I Subunit, Cav3.3, KIAA1120) (APC)

Gene Names
CACNA1I; Cav3.3; ca(v)3.3
Applications
Western Blot
Purity
Purified
Synonyms
CACNA1I; Monoclonal Antibody; CACNA1I (Calcium Channel; Voltage-Dependent; T Type; alpha 1I Subunit; Cav3.3; KIAA1120) (APC); Calcium Channel; KIAA1120; anti-CACNA1I antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F5
Specificity
Recognizes CACNA1I.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2223
Applicable Applications for anti-CACNA1I antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CACNA1I (NP_066919, 233aa-331aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CACNA1I is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNA1I is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-CACNA1I antibody
Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity. [supplied by OMIM]
Product Categories/Family for anti-CACNA1I antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
voltage-dependent T-type calcium channel subunit alpha-1I isoform a
NCBI Official Synonym Full Names
calcium voltage-gated channel subunit alpha1 I
NCBI Official Symbol
CACNA1I
NCBI Official Synonym Symbols
Cav3.3; ca(v)3.3
NCBI Protein Information
voltage-dependent T-type calcium channel subunit alpha-1I
UniProt Protein Name
Voltage-dependent T-type calcium channel subunit alpha-1I
UniProt Gene Name
CACNA1I
UniProt Synonym Gene Names
KIAA1120; Ca(v)3.3
UniProt Entry Name
CAC1I_HUMAN

NCBI Description

This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]

Uniprot Description

Function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H

By similarity.

Subunit structure: Interacts with CATSPER1 and CATSPER2, leading to suppress T-type calcium channel activity. Ref.6

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Brain specific.

Domain: Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Post-translational modification: In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II

By similarity.

Sequence similarities: Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1I subfamily. [View classification]

Research Articles on CACNA1I

Similar Products

Product Notes

The CACNA1I cacna1i (Catalog #AAA6169399) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CACNA1I can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNA1I cacna1i for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNA1I, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.