Mouse anti-Human CACNA1I Monoclonal Antibody | anti-CACNA1I antibody

CACNA1I (Voltage-dependent T-type Calcium Channel Subunit alpha-1I, Voltage-gated Calcium Channel Subunit alpha Cav3.3, Ca(v)3.3, KIAA1120) APC

Cat. Num. AAA6135616

• Gene Names: CACNA1I; Cav3.3; ca(v)3.3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CACNA1I; Monoclonal Antibody; CACNA1I (Voltage-dependent T-type Calcium Channel Subunit alpha-1I; Voltage-gated Calcium Channel Subunit alpha Cav3.3; Ca(v)3.3; KIAA1120) APC; anti-CACNA1I antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H5
• Specificity: Recognizes human CACNA1I.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2223

• Applicable Applications for anti-CACNA1I antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa233-332 from human CACNA1I (NP_066919) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CACNA1I is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-CACNA1I antibody

Calcium channel CaV3.3 (a1I) is a low-voltage-activated T-type calcium channel. Such T-type channels are expressed throughout the body. In heart, they may be involved in pacemaker current. In neurons, too, these channels may play a secondary pacemaker role. Three genes encoding T-type Ca2+ channels have been cloned and designated as CaV3.1 (a1G), CaV3.2 (a1H) and CaV3.3 (a1I). While CaV3.1 (a 1G) and CaV3.2 (a1H) are widely expressed in various tissues, CaV3.3 (a1I) is primarily expressed in the central nervous system, where high expression was described in thalamic neurons. The Ca2+ current generated by the CaV3.3 channel displays much slower activation and inactivation compared to the currents produced by CaV3.1 and CaV3.2, suggesting it might play a different role in neuronal excitability.

Product Categories/Family for anti-CACNA1I antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 21361077
• NCBI GeneID: 8911
• NCBI Accession #: NP_066919
• NCBI GenBank Nucleotide #: NM_021096
• UniProt Accession #: Q9P0X4
• NCBI Official Full Name: voltage-dependent T-type calcium channel subunit alpha-1I isoform a
• NCBI Official Synonym Full Names: calcium voltage-gated channel subunit alpha1 I
• NCBI Official Symbol: CACNA1I
• NCBI Official Synonym Symbols: Cav3.3; ca(v)3.3
• NCBI Protein Information: voltage-dependent T-type calcium channel subunit alpha-1I
• UniProt Protein Name: Voltage-dependent T-type calcium channel subunit alpha-1I
• Protein Family: Voltage-dependent T-type calcium channel
• UniProt Gene Name: CACNA1I
• UniProt Synonym Gene Names: KIAA1120; Ca(v)3.3
• UniProt Entry Name: CAC1I_HUMAN

NCBI Description

This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]

Uniprot Description

Function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H

By similarity.

Subunit structure: Interacts with CATSPER1 and CATSPER2, leading to suppress T-type calcium channel activity. Ref.6

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Brain specific.

Domain: Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

Post-translational modification: In response to raising of intracellular calcium, the T-type channels are activated by CaM-kinase II

By similarity.

Sequence similarities: Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1I subfamily. [View classification]