Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human BLZF1 Monoclonal Antibody | anti-BLZF1 antibody

BLZF1 (JEM1, Golgin-45, Basic Leucine Zipper Nuclear Factor 1, JEM-1, p45 Basic Leucine-zipper Nuclear Factor, MGC22497) (MaxLight 405)

Gene Names
BLZF1; JEM1; JEM-1; JEM-1s; GOLGIN-45
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BLZF1; Monoclonal Antibody; BLZF1 (JEM1; Golgin-45; Basic Leucine Zipper Nuclear Factor 1; JEM-1; p45 Basic Leucine-zipper Nuclear Factor; MGC22497) (MaxLight 405); anti-BLZF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E10
Specificity
Recognizes human BLZF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-BLZF1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa301-401 from BLZF1 (NP_003657) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BLZF1 antibody
Required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface.
Product Categories/Family for anti-BLZF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,362 Da
NCBI Official Full Name
Golgin-45
NCBI Official Synonym Full Names
basic leucine zipper nuclear factor 1
NCBI Official Symbol
BLZF1
NCBI Official Synonym Symbols
JEM1; JEM-1; JEM-1s; GOLGIN-45
NCBI Protein Information
Golgin-45; JEM-1short protein; cytoplasmic protein; p45 basic leucine-zipper nuclear factor
UniProt Protein Name
Golgin-45
Protein Family
UniProt Gene Name
BLZF1
UniProt Synonym Gene Names
JEM1
UniProt Entry Name
GO45_HUMAN

Uniprot Description

BLZF1: Required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q24

Cellular Component: nucleoplasm; Golgi membrane; Golgi lumen; cytoplasm; nucleus

Molecular Function: enzyme binding; DNA binding; ubiquitin protein ligase binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; cell proliferation; Golgi to plasma membrane protein transport; mitotic cell cycle; regulation of cell growth; Golgi organization and biogenesis

Similar Products

Product Notes

The BLZF1 blzf1 (Catalog #AAA6189091) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BLZF1 (JEM1, Golgin-45, Basic Leucine Zipper Nuclear Factor 1, JEM-1, p45 Basic Leucine-zipper Nuclear Factor, MGC22497) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BLZF1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BLZF1 blzf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BLZF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.