Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PCNASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PCNA Polyclonal Antibody | anti-PCNA antibody

PCNA Antibody - N-terminal region

Gene Names
PCNA; ATLD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PCNA; Polyclonal Antibody; PCNA Antibody - N-terminal region; anti-PCNA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM
Sequence Length
261
Applicable Applications for anti-PCNA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PCNA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PCNASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PCNASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PCNA antibody
This is a rabbit polyclonal antibody against PCNA. It was validated on Western Blot

Target Description: The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
proliferating cell nuclear antigen
NCBI Official Synonym Full Names
proliferating cell nuclear antigen
NCBI Official Symbol
PCNA
NCBI Official Synonym Symbols
ATLD2
NCBI Protein Information
proliferating cell nuclear antigen
UniProt Protein Name
Proliferating cell nuclear antigen
Protein Family
UniProt Gene Name
PCNA
UniProt Synonym Gene Names
PCNA
UniProt Entry Name
PCNA_HUMAN

NCBI Description

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq, Jul 2008]

Uniprot Description

PCNA: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'- 5' exonuclease and 3'-phosphodiesterase, but not apurinic- apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Homotrimer. Forms a complex with activator 1 heteropentamer in the presence of ATP. Interacts with EXO1, POLH, POLK, DNMT1, ERCC5, FEN1, CDC6 and POLDIP2. Interacts with APEX2; this interaction is triggered by reactive oxygen species and increased by misincorporation of uracil in nuclear DNA. Forms a ternary complex with DNTTIP2 and core histone. Interacts with KCTD10 and PPP1R15A. Interacts with POLD1, POLD3 and POLD4. Interacts with BAZ1B; the interaction is direct. Interacts with HLTF and SHPRH. Interacts with NUDT15. Interaction is disrupted in response to UV irradiation and acetylation. Interacts with p21Cip1/p21(CIP1) and CDT1; interacts via their PIP-box which also recruits the DCX(DTL) complex. Interacts with DDX11. Interacts with EGFR; positively regulates PCNA. Interacts with C12orf48/PARI. Interacts with SMARCAD1. Belongs to the PCNA family.

Protein type: DNA replication; Cell cycle regulation

Chromosomal Location of Human Ortholog: 20pter-p12

Cellular Component: nucleoplasm; centrosome; PCNA complex; nuclear replication fork; DNA replication factor C complex; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; DNA polymerase processivity factor activity; MutLalpha complex binding; purine-specific mismatch base pair DNA N-glycosylase activity; dinucleotide insertion or deletion binding; receptor tyrosine kinase binding

Biological Process: mismatch repair; positive regulation of deoxyribonuclease activity; heart development; DNA strand elongation during DNA replication; response to lipid; DNA repair; leading strand elongation; telomere maintenance via semi-conservative replication; G1/S-specific transcription in mitotic cell cycle; cell proliferation; bypass DNA synthesis; response to cadmium ion; epithelial cell differentiation; nucleotide-excision repair; base-excision repair; transcription-coupled nucleotide-excision repair; telomere maintenance via recombination; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; telomere maintenance; regulation of DNA replication; G1/S transition of mitotic cell cycle

Disease: Ataxia-telangiectasia-like Disorder 2

Research Articles on PCNA

Similar Products

Product Notes

The PCNA pcna (Catalog #AAA3219138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCNA Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCNA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCNA pcna for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMGVNLTSMS KILKCAGNED IITLRAEDNA DTLALVFEAP NQEKVSDYEM. It is sometimes possible for the material contained within the vial of "PCNA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.