<
Western Blot (WB)
(Western Blot detection against Immunogen (50.2kD).)
Mouse anti-Human, Mouse TRAPPC4 Monoclonal Antibody | anti-TRAPPC4 antibody
TRAPPC4 (Trafficking Protein Particle Complex Subunit 4, Synbindin, TRS23 Homolog, Hematopoietic Stem/Progenitor Cell Protein 172, SBDN, CGI-104, HSPC172, PTD009)
Gene Names
TRAPPC4; SBDN; TRS23; PTD009; CGI-104; HSPC172; SYNBINDIN
Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TRAPPC4; Monoclonal Antibody; TRAPPC4 (Trafficking Protein Particle Complex Subunit 4; Synbindin; TRS23 Homolog; Hematopoietic Stem/Progenitor Cell Protein 172; SBDN; CGI-104; HSPC172; PTD009); Anti -TRAPPC4 (Trafficking Protein Particle Complex Subunit 4; anti-TRAPPC4 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Specificity
Recognizes human TRAPPC4. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Applicable Applications for anti-TRAPPC4 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 30ug/ml
Dilution: Immunofluorescence: 30ug/ml
Immunogen
Full length recombinant corresponding to aa1-220 from human TRAPPC4 (AAH10866) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (50.2kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (50.2kD).)
Western Blot (WB)
(TRAPPC4 monoclonal antibody, Western Blot analysis of TRAPPC4 expression in HeLa.)
Western Blot (WB)
(TRAPPC4 monoclonal antibody, Western Blot analysis of TRAPPC4 expression in HeLa.)
Western Blot (WB)
(TRAPPC4 monoclonal antibody. Western Blot analysis of TRAPPC4 expression in Raw 264.7.)
Western Blot (WB)
(TRAPPC4 monoclonal antibody. Western Blot analysis of TRAPPC4 expression in Raw 264.7.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRAPPC4 on HeLa cell. [antibody concentration 30ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TRAPPC4 on HeLa cell. [antibody concentration 30ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged TRAPPC4 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRAPPC4 is ~0.03ng/ml as a capture antibody.)
Western Blot (WB)
(TRAPPC4 monoclonal antibody. Western Blot analysis of TRAPPC4 expression in NIH/3T3.)
Western Blot (WB)
(TRAPPC4 monoclonal antibody. Western Blot analysis of TRAPPC4 expression in NIH/3T3.)
Related Product Information for anti-TRAPPC4 antibody
TRAPPC4 is part of the multisubunit TRAPP (transport protein particle) complex and interacts with SDC2. It may play a role in vesicular transport from endoplasmic reticulum to Golgi. TRAPP proteins are involved in tethering during vesicle transport.
Product Categories/Family for anti-TRAPPC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,340 Da
NCBI Official Full Name
trafficking protein particle complex subunit 4
NCBI Official Synonym Full Names
trafficking protein particle complex 4
NCBI Official Symbol
TRAPPC4
NCBI Official Synonym Symbols
SBDN; TRS23; PTD009; CGI-104; HSPC172; SYNBINDIN
NCBI Protein Information
trafficking protein particle complex subunit 4; TRS23 homolog; hematopoietic stem/progenitor cell protein 172
UniProt Protein Name
Trafficking protein particle complex subunit 4
Protein Family
UniProt Gene Name
TRAPPC4
UniProt Synonym Gene Names
SBDN
UniProt Entry Name
TPPC4_HUMAN
Uniprot Description
TRAPPC4: May play a role in vesicular transport from endoplasmic reticulum to Golgi. Belongs to the TRAPP small subunits family. TRAPPC4 subfamily.
Protein type: Cell development/differentiation; Vesicle
Chromosomal Location of Human Ortholog: 11q23.3
Cellular Component: synaptic vesicle; Golgi stack; cis-Golgi network; endoplasmic reticulum; dendrite; synapse
Molecular Function: protein binding; Rab guanyl-nucleotide exchange factor activity
Biological Process: ER to Golgi vesicle-mediated transport; extracellular matrix organization and biogenesis; dendrite development
Research Articles on TRAPPC4
Similar Products
Product Notes
The TRAPPC4 trappc4 (Catalog #AAA6004533) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRAPPC4 (Trafficking Protein Particle Complex Subunit 4, Synbindin, TRS23 Homolog, Hematopoietic Stem/Progenitor Cell Protein 172, SBDN, CGI-104, HSPC172, PTD009) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TRAPPC4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 30ug/ml. Researchers should empirically determine the suitability of the TRAPPC4 trappc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAIFSVYVVN KAGGLIYQLD SYAPRAEAEK TFSYPLDLLL KLHDERVLVA FGQRDGIRVG HAVLAINGMD VNGRYTADGK EVLEYLGNPA NYPVSIRFGR PRLTSNEKLM LASMFHSLFA IGSQLSPEQG SSGIEMLETD TFKLHCYQTL TGIKFVVLAD PRQAGIDSLL RKIYEIYSDF ALKNPFYSLE MPIRCELFDQ NLKLALEVAE KAGTFGPGS. It is sometimes possible for the material contained within the vial of "TRAPPC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
