Western Blot (WB)
(Western Blot detection against Immunogen (46.9kD).)
Mouse anti-Human BATF2 Monoclonal Antibody | anti-BATF2 antibody
BATF2 (Basic Leucine Zipper Transcriptional Factor ATF-like 2, Suppressor of AP-1 Regulated by IFN, MGC20410) (Biotin)
Gene Names
BATF2; SARI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BATF2; Monoclonal Antibody; BATF2 (Basic Leucine Zipper Transcriptional Factor ATF-like 2; Suppressor of AP-1 Regulated by IFN; MGC20410) (Biotin); anti-BATF2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B11
Specificity
Recognizes human BATF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BATF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-190 from human BATF2 (AAH12330) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (46.9kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (46.9kD).)
Testing Data
(Detection limit for recombinant GST tagged BATF2 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged BATF2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-BATF2 antibody
AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates to the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Selectively suppresses CYR61/CCN1 transcription and hence blocks the downstream cell proliferation signals produced by CYR61 and inhibits CYR61-induced anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma. Possibly acts by interfering with AP-1 binding to CYR61 promoter.
Product Categories/Family for anti-BATF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
19,503 Da
NCBI Official Full Name
Homo sapiens basic leucine zipper transcription factor, ATF-like 2, mRNA
NCBI Official Synonym Full Names
basic leucine zipper ATF-like transcription factor 2
NCBI Official Symbol
BATF2
NCBI Official Synonym Symbols
SARI
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like 2
Protein Family
Research Articles on BATF2
Similar Products
Product Notes
The BATF2 (Catalog #AAA6140792) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BATF2 (Basic Leucine Zipper Transcriptional Factor ATF-like 2, Suppressor of AP-1 Regulated by IFN, MGC20410) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BATF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BATF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BATF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
