Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse AVEN Monoclonal Antibody | anti-AVEN antibody

AVEN (Cell Death Regulator Aven, PDCD12) (HRP)

Gene Names
AVEN; PDCD12
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AVEN; Monoclonal Antibody; AVEN (Cell Death Regulator Aven; PDCD12) (HRP); anti-AVEN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B10
Specificity
Recognizes human AVEN. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-AVEN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-171 from human AVEN (NP_065104) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(AVEN monoclonal antibody. Western Blot analysis of AVEN expression in PC-12.)

Western Blot (WB) (AVEN monoclonal antibody. Western Blot analysis of AVEN expression in PC-12.)

Western Blot (WB)

(AVEN monoclonal antibody. Western Blot analysis of AVEN expression in Jurkat.)

Western Blot (WB) (AVEN monoclonal antibody. Western Blot analysis of AVEN expression in Jurkat.)

Western Blot (WB)

(AVEN monoclonal antibody. Western Blot analysis of AVEN expression in NIH/3T3.)

Western Blot (WB) (AVEN monoclonal antibody. Western Blot analysis of AVEN expression in NIH/3T3.)
Related Product Information for anti-AVEN antibody
AVEN protects against apoptosis mediated by Apaf-1.
Product Categories/Family for anti-AVEN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,506 Da
NCBI Official Full Name
cell death regulator Aven
NCBI Official Synonym Full Names
apoptosis, caspase activation inhibitor
NCBI Official Symbol
AVEN
NCBI Official Synonym Symbols
PDCD12
NCBI Protein Information
cell death regulator Aven; programmed cell death 12
UniProt Protein Name
Cell death regulator Aven
Protein Family
UniProt Gene Name
AVEN
UniProt Entry Name
AVEN_HUMAN

Uniprot Description

AVEN: Protects against apoptosis mediated by Apaf-1. Binds Apaf-1, BCL-2 and BAD (Bcl-xl). Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.

Protein type: Inhibitor; Apoptosis

Chromosomal Location of Human Ortholog: 15q13.1

Cellular Component: membrane; endomembrane system; intracellular

Molecular Function: protein binding

Biological Process: apoptosis; negative regulation of apoptosis

Research Articles on AVEN

Similar Products

Product Notes

The AVEN aven (Catalog #AAA6151366) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AVEN (Cell Death Regulator Aven, PDCD12) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AVEN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AVEN aven for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AVEN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.