Mouse anti-Human ATP6V1D Monoclonal Antibody | anti-ATP6V1D antibody

ATP6V1D (V-type Proton ATPase Subunit D, V-ATPase Subunit D, V-ATPase 28kD Accessory Protein, Vacuolar Proton Pump Subunit D, ATP6M, VATD) (AP)

Cat. Num. AAA6130137

• Gene Names: ATP6V1D; VATD; VMA8; ATP6M
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP6V1D; Monoclonal Antibody; ATP6V1D (V-type Proton ATPase Subunit D; V-ATPase Subunit D; V-ATPase 28kD Accessory Protein; Vacuolar Proton Pump Subunit D; ATP6M; VATD) (AP); anti-ATP6V1D antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G4
• Specificity: Recognizes human ATP6V1D.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ATP6V1D antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa69-169 from human ATP6V1D (NP_057078) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP6V1D on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2ug/ml].)

Product Categories/Family for anti-ATP6V1D antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 7706757
• NCBI GeneID: 51382
• NCBI Accession #: NP_057078
• NCBI GenBank Nucleotide #: NM_015994
• UniProt Accession #: Q9Y5K8; Q9Y688; B2RE33
• Molecular Weight: 28,263 Da
• NCBI Official Full Name: V-type proton ATPase subunit D
• NCBI Official Synonym Full Names: ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
• NCBI Official Symbol: ATP6V1D
• NCBI Official Synonym Symbols: VATD; VMA8; ATP6M
• NCBI Protein Information: V-type proton ATPase subunit D; ATPase, H+ transporting lysosomal, member M; ATPase, H+ transporting, lysosomal (vacuolar proton pump); H(+)-transporting two-sector ATPase, subunit M; V-ATPase 28 kDa accessory protein; V-ATPase D subunit; V-ATPase subunit
• UniProt Protein Name: V-type proton ATPase subunit D
• UniProt Gene Name: ATP6V1D
• UniProt Synonym Gene Names: ATP6M; VATD; V-ATPase subunit D
• UniProt Entry Name: VATD_HUMAN

Uniprot Description

ATP6V1D: Subunit of the peripheral V1 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Belongs to the V-ATPase D subunit family.

Protein type: EC 3.6.3.14; Hydrolase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 14q23-q24.2

Cellular Component: centrosome; membrane; lysosomal membrane; cytosol; cilium

Molecular Function: protein binding; ATPase activity, coupled to transmembrane movement of substances

Biological Process: interaction with host; proton transport; cellular iron ion homeostasis; insulin receptor signaling pathway; cilium biogenesis; transferrin transport; transmembrane transport