Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11.Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa).Lane 2: Non-transfected lysate.)

Mouse ATP6AP1 Monoclonal Antibody | anti-ATP6AP1 antibody

ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1, 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3) (HRP)

Gene Names
ATP6AP1; 16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ATP6AP1; Monoclonal Antibody; ATP6AP1 (ATPase; H+ Transporting; Lysosomal Accessory Protein 1; 16A; ATP6IP1; ATP6S1; Ac45; CF2; MGC129781; VATPS1; XAP-3; XAP3) (HRP); ATPase; XAP3; anti-ATP6AP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B11
Specificity
Recognizes ATP6AP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ATP6AP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATP6AP1 (NP_001174, 51aa-150aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11.Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M02), clone 3B11.Lane 1: ATP6AP1 transfected lysate (Predicted MW: 52 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ATP6AP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
537
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52
NCBI Official Full Name
V-type proton ATPase subunit S1
NCBI Official Synonym Full Names
ATPase H+ transporting accessory protein 1
NCBI Official Symbol
ATP6AP1
NCBI Official Synonym Symbols
16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
NCBI Protein Information
V-type proton ATPase subunit S1
UniProt Protein Name
V-type proton ATPase subunit S1
Protein Family
UniProt Gene Name
ATP6AP1
UniProt Synonym Gene Names
ATP6IP1; ATP6S1; VATPS1; XAP3; V-ATPase subunit S1
UniProt Entry Name
VAS1_HUMAN

NCBI Description

This gene encodes a component of a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. This protein may also play a role in early development. [provided by RefSeq, Aug 2013]

Uniprot Description

ATP6AP1: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the vacuolar ATPase subunit S1 family.

Protein type: Transporter; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Hydrolase; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: vacuolar membrane; integral to membrane; endosome membrane; proton-transporting two-sector ATPase complex

Molecular Function: transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism; Rab GTPase binding; ATP binding

Biological Process: positive regulation of osteoblast differentiation; proton transport; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; pH reduction; insulin receptor signaling pathway; positive regulation of bone resorption; transferrin transport; transmembrane transport; establishment of organelle localization; positive regulation of exocytosis

Research Articles on ATP6AP1

Similar Products

Product Notes

The ATP6AP1 atp6ap1 (Catalog #AAA6182691) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATP6AP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6AP1 atp6ap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6AP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.