Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ATP6AP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

Rabbit ATP6AP1 Polyclonal Antibody | anti-ATP6AP1 antibody

ATP6AP1 antibody - middle region

Gene Names
ATP6AP1; 16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP6AP1; Polyclonal Antibody; ATP6AP1 antibody - middle region; anti-ATP6AP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
Sequence Length
470
Applicable Applications for anti-ATP6AP1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATP6AP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ATP6AP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-ATP6AP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-ATP6AP1 antibody
This is a rabbit polyclonal antibody against ATP6AP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.
Product Categories/Family for anti-ATP6AP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
537
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52
NCBI Official Full Name
V-type proton ATPase subunit S1
NCBI Official Synonym Full Names
ATPase H+ transporting accessory protein 1
NCBI Official Symbol
ATP6AP1
NCBI Official Synonym Symbols
16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1
NCBI Protein Information
V-type proton ATPase subunit S1
UniProt Protein Name
V-type proton ATPase subunit S1
Protein Family
UniProt Gene Name
ATP6AP1
UniProt Synonym Gene Names
ATP6IP1; ATP6S1; VATPS1; XAP3; V-ATPase subunit S1
UniProt Entry Name
VAS1_HUMAN

NCBI Description

This gene encodes a component of a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. This protein may also play a role in early development. [provided by RefSeq, Aug 2013]

Uniprot Description

ATP6AP1: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the vacuolar ATPase subunit S1 family.

Protein type: Transporter; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Hydrolase; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: vacuolar membrane; integral to membrane; endosome membrane; proton-transporting two-sector ATPase complex

Molecular Function: transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism; Rab GTPase binding; ATP binding

Biological Process: positive regulation of osteoblast differentiation; proton transport; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; pH reduction; insulin receptor signaling pathway; positive regulation of bone resorption; transferrin transport; transmembrane transport; establishment of organelle localization; positive regulation of exocytosis

Research Articles on ATP6AP1

Similar Products

Product Notes

The ATP6AP1 atp6ap1 (Catalog #AAA3207648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6AP1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6AP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6AP1 atp6ap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPVIHPPVSY NDTAPRILFW AQNFSVAYKD QWEDLTPLTF GVQELNLTGS. It is sometimes possible for the material contained within the vial of "ATP6AP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.